BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_G04_e31_14.seq (1561 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 216 3e-56 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 6e-21 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 3e-20 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 95 1e-19 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 93 4e-19 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 93 7e-19 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 91 2e-18 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 4e-18 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 8e-16 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 80 4e-15 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 80 4e-15 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 80 4e-15 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 2e-14 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 4e-14 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 9e-14 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 4e-12 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 63 5e-10 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 7e-10 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-09 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 61 3e-09 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 8e-08 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 56 1e-07 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46507| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 9e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 52 2e-06 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 52 2e-06 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 52 2e-06 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 52 2e-06 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 52 2e-06 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 52 2e-06 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 52 2e-06 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 51 2e-06 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-06 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 48 2e-05 SB_27674| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 48 3e-05 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 48 3e-05 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 48 3e-05 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 48 3e-05 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 48 3e-05 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 48 3e-05 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 48 3e-05 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 48 3e-05 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 48 3e-05 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 48 3e-05 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 48 3e-05 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 48 3e-05 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 48 3e-05 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 48 3e-05 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 48 3e-05 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 48 3e-05 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 48 3e-05 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 48 3e-05 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 48 3e-05 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 48 3e-05 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 48 3e-05 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 48 3e-05 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 48 3e-05 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 48 3e-05 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 48 3e-05 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 48 3e-05 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 48 3e-05 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 48 3e-05 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 48 3e-05 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 48 3e-05 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 48 3e-05 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 48 3e-05 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 48 3e-05 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 48 3e-05 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 48 3e-05 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 48 3e-05 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 48 3e-05 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 48 3e-05 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 47 4e-05 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 47 4e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 47 4e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 47 4e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 47 4e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 47 4e-05 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 46 6e-05 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 46 6e-05 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 45 1e-04 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 45 1e-04 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 45 1e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 45 1e-04 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 45 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 45 2e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 45 2e-04 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 44 3e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 44 3e-04 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 44 3e-04 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 3e-04 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 44 3e-04 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 44 3e-04 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 44 3e-04 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 44 3e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 44 3e-04 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 44 3e-04 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 44 3e-04 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 44 3e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 44 3e-04 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 44 3e-04 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 44 3e-04 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 44 3e-04 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 44 3e-04 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 3e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 44 3e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 44 3e-04 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 44 3e-04 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 44 3e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 44 3e-04 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 44 3e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 44 3e-04 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 44 3e-04 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 44 3e-04 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 44 3e-04 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 44 3e-04 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 44 3e-04 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 44 3e-04 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 44 3e-04 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 44 3e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 44 3e-04 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 44 3e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 44 3e-04 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 44 3e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 44 3e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 44 3e-04 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 44 3e-04 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 44 3e-04 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 44 3e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 44 3e-04 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 216 bits (528), Expect = 3e-56 Identities = 97/150 (64%), Positives = 122/150 (81%), Gaps = 12/150 (8%) Frame = +2 Query: 86 MADQTERSFQKQPTVFLNRKKGIGVKRSRKPLRYHKDVGLGFKTP------------REA 229 MA+QTER++QKQ +F NRK+ +G +K LR+ ++VGLGFKTP REA Sbjct: 1 MAEQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREA 60 Query: 230 VEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMS 409 +EGTYIDKKCPFTGNVSIRGRILTG+ + MKM+RTI+IRRDYLHY+ KYNRFEKRH+N++ Sbjct: 61 IEGTYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYIKKYNRFEKRHKNLA 120 Query: 410 VHLSPCFRDVEIGDIVTIGECRPLSKTVRF 499 H SPCFRD+ +GD++T+G+CRPLSKTVRF Sbjct: 121 AHCSPCFRDIALGDLITVGQCRPLSKTVRF 150 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 99.5 bits (237), Expect = 6e-21 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -2 Query: 756 GLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GL AITPAGERGMCCKA K+G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 12 GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 34.3 bits (75), Expect = 0.27 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = -3 Query: 785 ATVGKGDRXGASXLLRQLAKGGCAARRXKLGNARVFP 675 ATVGKGDR G + +G C + KLGNA+ FP Sbjct: 3 ATVGKGDRCGLFAITPAGERGMC-CKAIKLGNAKGFP 38 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 97.1 bits (231), Expect = 3e-20 Identities = 43/54 (79%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GR++ GL AITPAGERGMCCKA K+G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 95.5 bits (227), Expect = 1e-19 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -2 Query: 756 GLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GL AITPAGERGMCCKA K+G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 6 GLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 93.5 bits (222), Expect = 4e-19 Identities = 41/54 (75%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GR++ GL AITPAGERGMCCK+ K+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 92.7 bits (220), Expect = 7e-19 Identities = 42/53 (79%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRAN 616 GRS+ GL AITPAGERGMCCKA K+G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 91.1 bits (216), Expect = 2e-18 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = +1 Query: 592 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 T GGA PIRPIVSRITIHWP+FYN TGKTLA RLAAHPPFASWRNS EA Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEA 86 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 90.2 bits (214), Expect = 4e-18 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GR++ GL AITPAGERGMCCKA K+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1847 GRAIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTLALPN LAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEA 43 Score = 29.5 bits (63), Expect = 7.6 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L AL P + ++ TDRPSQQL SL EW Sbjct: 17 GKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 85.4 bits (202), Expect = 1e-16 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -1 Query: 790 AXQLLGRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 A QLLG+ GPL YYASWRKGDVLQ SWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 85.0 bits (201), Expect = 1e-16 Identities = 40/55 (72%), Positives = 45/55 (81%), Gaps = 2/55 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAX-KVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 GR++ GL AITPAGE+G + K+G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 37.1 bits (82), Expect = 0.038 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -1 Query: 799 PFKAXQLLGRAIGXGPLXYYASWRKGDVLQG 707 P +A QLLGRAIG G + KGDVLQG Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKGDVLQG 70 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.6 bits (195), Expect = 8e-16 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTLALPN L HPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEA 43 Score = 29.9 bits (64), Expect = 5.8 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQ P + ++ TDRPSQ+L SL EW Sbjct: 17 GKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 1e-15 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -1 Query: 778 LGRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +G+ GPL YYASWRKGDVLQG SWVTPGFSQSRRCKTTASEL Sbjct: 5 VGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.0 bits (191), Expect = 2e-15 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTL++ RLAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEA 43 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 80.2 bits (189), Expect = 4e-15 Identities = 42/74 (56%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = -2 Query: 819 AYNLPIR---HS--RLXNCWEGRSVXGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKR 655 A N P++ HS RL NCWEGRSV + + G C A ++ GFPSHDVVKR Sbjct: 579 ALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKR 634 Query: 654 RPVNCNTTHYRANW 613 RPVNCNTTHYRANW Sbjct: 635 RPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 80.2 bits (189), Expect = 4e-15 Identities = 42/74 (56%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = -2 Query: 819 AYNLPIR---HS--RLXNCWEGRSVXGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKR 655 A N P++ HS RL NCWEGRSV + + G C A ++ GFPSHDVVKR Sbjct: 22 ALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKR 77 Query: 654 RPVNCNTTHYRANW 613 RPVNCNTTHYRANW Sbjct: 78 RPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 80.2 bits (189), Expect = 4e-15 Identities = 42/74 (56%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = -2 Query: 819 AYNLPIR---HS--RLXNCWEGRSVXGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKR 655 A N P++ HS RL NCWEGRSV + + G C A ++ GFPSHDVVKR Sbjct: 22 ALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKR 77 Query: 654 RPVNCNTTHYRANW 613 RPVNCNTTHYRANW Sbjct: 78 RPVNCNTTHYRANW 91 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 77.8 bits (183), Expect = 2e-14 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTLALPN L PPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEA 43 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQHIP + ++ TDRPSQQL SL EW Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 77.0 bits (181), Expect = 4e-14 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 792 RLXNCWEGRSVXGLXAITPAGERGMCCKAXKVG*-RQGFPSHDVVKRRPVNCNTTHYRAN 616 +L NCWEGRSV + + G C A ++ GFPSHDVVKRRPVNCNTTHYRAN Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRAN 79 Query: 615 W 613 W Sbjct: 80 W 80 Score = 37.5 bits (83), Expect = 0.029 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -3 Query: 806 PFAIQGXATVGKGDRXGASXLLRQLAKGGCAARR 705 P +Q +G AS LLRQLAKGGCAARR Sbjct: 17 PRLVQQLRNCWEGRSVRASSLLRQLAKGGCAARR 50 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.6 bits (180), Expect = 5e-14 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGK + RLAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEA 43 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.6 bits (180), Expect = 5e-14 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGK + RLAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEA 43 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 75.8 bits (178), Expect = 9e-14 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGK + RLAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 71.7 bits (168), Expect = 1e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +1 Query: 646 HWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 HWPSFYNVVTGKTL + RLAAHPPFASWRNS EA Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEA 41 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.7 bits (168), Expect = 1e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -2 Query: 729 ERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRAN 616 ERGMCCKA K+G F SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.1 bits (164), Expect = 4e-12 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNV+ KT + RLAAHPPFASWRNS +A Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKA 43 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 68.9 bits (161), Expect = 1e-11 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -1 Query: 757 GPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 GPL YYASWRKG SWVTPGFSQSRRCKTTASEL Sbjct: 72 GPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 68.1 bits (159), Expect = 2e-11 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVV + + RLAAHPPFASWRNS EA Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 2e-11 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +1 Query: 616 IRPIVSRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 IRPIVSRITIHWPSFY + + RLAAHPPFASWR+S EA Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEA 64 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 66.9 bits (156), Expect = 4e-11 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = -1 Query: 778 LGRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +G+ GPL YYASWRKGD S TPGFSQSRRCKTTASEL Sbjct: 34 VGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 66.5 bits (155), Expect = 5e-11 Identities = 36/75 (48%), Positives = 44/75 (58%), Gaps = 5/75 (6%) Frame = -2 Query: 906 GILPNXGLXVKK*AXLTKNLTRNFNQNIXAYNLPIR---HS--RLXNCWEGRSVXGLXAI 742 G++ N + A + +T A N P++ HS RL NCWEGRSV GL AI Sbjct: 4 GVVRNGKSTARTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRGLFAI 63 Query: 741 TPAGERGMCCKAXKV 697 TPAGERGMCCKA K+ Sbjct: 64 TPAGERGMCCKAIKL 78 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -2 Query: 765 SVXGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPVNCNTTHYRANW 613 +V + A TP+G++ M ++ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 9 TVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 4e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 690 RQGFPSHDVVKRRPVNCNTTHYRANW 613 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 63.3 bits (147), Expect = 5e-10 Identities = 36/55 (65%), Positives = 36/55 (65%) Frame = +1 Query: 592 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 T GGA PIRPIVS ITIHWPSFYN VT AHPPFASWRNS EA Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEA 75 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 62.9 bits (146), Expect = 7e-10 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = +1 Query: 646 HWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 HWPSFYN VTGKTLALPN L P FASWRNS EA Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEA 41 Score = 33.9 bits (74), Expect = 0.35 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQ 781 GK P L ALQHIP + ++ TDRPSQQ Sbjct: 15 GKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.1 bits (144), Expect = 1e-09 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTLALPN L P +AS S EA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEA 43 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/43 (48%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L L+HIPL + ++ TDRPSQQL SL EW Sbjct: 17 GKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 684 GFPSHDVVKRRPVNCNTTHYRANW 613 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 60.9 bits (141), Expect = 3e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEAPHRSPFPTVAQP 792 RLAAHPPFASWRNS E PHRSPFPTVAQP Sbjct: 363 RLAAHPPFASWRNS-ERPHRSPFPTVAQP 390 Score = 37.9 bits (84), Expect = 0.022 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 660 LQRRDWENPGVTQLXSPCSTSPF 728 LQRRDWENPGVTQL + PF Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPF 370 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 60.9 bits (141), Expect = 3e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 616 IRPIVSRITIHWPSFYNVVTGKTLALPNFXRLAAHP 723 +RP+VSRITIHW SFYNVVTGKTLALPN L P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/43 (69%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQHIPLSPAGVIA+ TDRPSQQL SL EW Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 59.7 bits (138), Expect = 6e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 661 YNVVTGKTLALPNFXRLAAHPPFASWRNSXEAPHRSPFPTVAQP 792 Y+VVTGKTLA+P+ L P FASWR +PHRSPFP AQP Sbjct: 13 YDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFPRDAQP 56 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = +2 Query: 647 TGRRFTTS*LGKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSLEWRM 805 TGRR GK P+L ALQHIP + R P + EWRM Sbjct: 8 TGRRVYDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFPRDAQPEWRM 60 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.8 bits (136), Expect = 1e-08 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGKTLALPN L P + NS EA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEA 43 Score = 54.4 bits (125), Expect = 2e-07 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQHIPLSPAGV ++ TDRPSQQL SL EW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 622 PIVSRITIHWPSFYNVVTGKTLALPNFXRLAAHP 723 P +SRITIHWPSFYNVVTGKTLALPN L P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 Score = 52.4 bits (120), Expect = 9e-07 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQHIPLSPAG+ + TDRPSQQL SL EW Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 56.0 bits (129), Expect = 8e-08 Identities = 29/43 (67%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGK-TLALPNFXRLAAHPPFASWRNSXEA 756 SRITIHWPSFYNVVTGK T P+ L P ASWRNS EA Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEA 44 Score = 35.9 bits (79), Expect = 0.088 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +2 Query: 689 RYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 R P+L LQ+IPL + ++ TDRPSQQL SL EW Sbjct: 22 REPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 55.6 bits (128), Expect = 1e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +1 Query: 631 SRITIHWPSFYNVVTGKTLALPNFXRLAAHP 723 SRITIHWPSFYNVVTGKTLALPN L P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 GK P L ALQHIPLSPAGVIAKRP +QL SL EW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 Score = 29.9 bits (64), Expect = 5.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 756 PXPIALPNSCXALNGEW 806 P PIALP +LNGEW Sbjct: 43 PAPIALPKQLRSLNGEW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 54.8 bits (126), Expect = 2e-07 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = +1 Query: 628 VSRITIHWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 +SRITIHWPS + + RLAAHPPFASWRNS EA Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 319 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.4 bits (125), Expect = 2e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 661 YNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 YNVVTGKT + RLAAHPPFASWRNS EA Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEA 43 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 54.4 bits (125), Expect = 2e-07 Identities = 28/45 (62%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EWRM 805 GK P L ALQHIPLSPAG ++ TDRPSQQL SL EWR+ Sbjct: 15 GKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRL 59 Score = 53.2 bits (122), Expect = 5e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 646 HWPSFYNVVTGKTLALPNFXRLAAHPPFASWRNSXEA 756 HWPSFYNVVTGKTLALPN L P + RNS EA Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEA 41 >SB_46507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 52.8 bits (121), Expect = 7e-07 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = +2 Query: 692 YPTLXALQHIPLSPAGVIAKRPXTDRPSQQLXSL--EWRM 805 +P L AL HIPLSPAGVIA+ TDRPSQQ+ L +WR+ Sbjct: 20 FPLLIALHHIPLSPAGVIAEEARTDRPSQQMHILNGKWRL 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 9e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 672 HDVVKRRPVNCNTTHYRANW 613 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 9e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 672 HDVVKRRPVNCNTTHYRANW 613 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 52.0 bits (119), Expect = 1e-06 Identities = 29/54 (53%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = -2 Query: 801 RHS--RLXNCWEGRSVXGLXAITPAGERGMCCKAXKVG*RQGFPSHDVVKRRPV 646 RHS RL NCWEGRSV + + G C A ++ GFPSHDVVKRRPV Sbjct: 18 RHSPFRLRNCWEGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKRRPV 67 Score = 37.1 bits (82), Expect = 0.038 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARRXKLG 693 +G AS LLRQLAKGGCAARR G Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWG 55 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 215 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 370 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 286 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 26 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 260 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 444 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 279 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 129 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 580 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 494 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 178 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 51.2 bits (117), Expect = 2e-06 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 808 AHSPFKAXQL-LGRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL 641 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASEL Sbjct: 44 SHSPFRLRNCGEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTASEL*YD 632 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTASE D Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEFPGD 60 Query: 631 SL 626 L Sbjct: 61 PL 62 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPF 111 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 104 RLAAHPPFASWRNSEEA 120 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 48.0 bits (109), Expect = 2e-05 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 31 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_27674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +2 Query: 716 HIPLSPAGVIAKRPXTDRPSQQLXSL--EW 799 HIPLSPAGVIAK TDRPSQQL SL EW Sbjct: 1 HIPLSPAGVIAKSARTDRPSQQLRSLNGEW 30 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 65 HSPFRLRNYWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*RQGFP 676 GR++ GL AITPAGERGMCCKA K+G + FP Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = -3 Query: 806 PFAIQGXATVGKGDRXGASXLLRQLAKGGCAARRXKLGNARVFPVTT 666 PFAIQ +G+ G + +G C + KLGNARVFPVTT Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCC-KAIKLGNARVFPVTT 56 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 778 LGRAIGXGPLXYYASWRKGDVLQG 707 +G+ GPL YYASWRKGDVLQG Sbjct: 94 VGKGDRCGPLRYYASWRKGDVLQG 117 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 68 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 805 HSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 918 SWVTPGFSQSRRCKTTASEL 937 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 894 EGRSVRASSLLRQLAKGGCAARR 916 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 31 SWVTPGFSQSRRCKTTASEL 50 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 7 EGRSVRASSLLRQLAKGGCAARR 29 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 30 SWVTPGFSQSRRCKTTASEL 49 Score = 36.7 bits (81), Expect = 0.050 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -3 Query: 785 ATVGKGDRXGASXLLRQLAKGGCAARR 705 A + +G AS LLRQLAKGGCAARR Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARR 28 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 254 SWVTPGFSQSRRCKTTASEL 273 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 230 EGRSVRASSLLRQLAKGGCAARR 252 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 387 SWVTPGFSQSRRCKTTASEL 406 Score = 36.3 bits (80), Expect = 0.066 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -3 Query: 791 GXATVGKGDRXGASXLLRQLAKGGCAARR 705 G +G AS LLRQLAKGGCAARR Sbjct: 357 GLRNCWEGRSVRASSLLRQLAKGGCAARR 385 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 31 SWVTPGFSQSRRCKTTASEL 50 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 7 EGRSVRASSLLRQLAKGGCAARR 29 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 31 SWVTPGFSQSRRCKTTASEL 50 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 7 EGRSVRASSLLRQLAKGGCAARR 29 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 297 SWVTPGFSQSRRCKTTASEL 316 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 273 EGRSVRASSLLRQLAKGGCAARR 295 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 281 SWVTPGFSQSRRCKTTASEL 300 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 257 EGRSVRASSLLRQLAKGGCAARR 279 Score = 30.7 bits (66), Expect = 3.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 807 PIRHSRLXNCWEGRSVXGLXAITPAGERGMCCK 709 P+ +L NCWEGRSV + + G + Sbjct: 246 PVNREKLRNCWEGRSVRASSLLRQLAKGGCAAR 278 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 31 SWVTPGFSQSRRCKTTASEL 50 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 7 EGRSVRASSLLRQLAKGGCAARR 29 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 270 SWVTPGFSQSRRCKTTASEL 289 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 246 EGRSVRASSLLRQLAKGGCAARR 268 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 148 SWVTPGFSQSRRCKTTASEL 167 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 124 EGRSVRASSLLRQLAKGGCAARR 146 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 357 SWVTPGFSQSRRCKTTASEL 376 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 KG LLRQL KGGCAARR Sbjct: 333 KGRSVRTYSLLRQLVKGGCAARR 355 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 24 SWVTPGFSQSRRCKTTASEL 43 Score = 35.5 bits (78), Expect = 0.12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 755 ASXLLRQLAKGGCAARR 705 AS LLRQLAKGGCAARR Sbjct: 6 ASSLLRQLAKGGCAARR 22 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 223 SWVTPGFSQSRRCKTTASEL 242 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 199 EGRSVRASSLLRQLAKGGCAARR 221 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 251 SWVTPGFSQSRRCKTTASEL 270 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 227 EGRSVRASSLLRQLAKGGCAARR 249 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 112 SWVTPGFSQSRRCKTTASEL 131 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = -3 Query: 812 ICPFAIQGXATVGKGDRXGASXLLRQLAKGGCAARR 705 + P A+ G +G AS LLRQLAKGGCAARR Sbjct: 75 LMPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARR 110 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 420 SWVTPGFSQSRRCKTTASEL 439 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 396 EGRSVRASSLLRQLAKGGCAARR 418 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 47.2 bits (107), Expect = 4e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASEL 641 SWVTPGFSQSRRCKTTASEL Sbjct: 24 SWVTPGFSQSRRCKTTASEL 43 Score = 35.5 bits (78), Expect = 0.12 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 755 ASXLLRQLAKGGCAARR 705 AS LLRQLAKGGCAARR Sbjct: 6 ASSLLRQLAKGGCAARR 22 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 46.8 bits (106), Expect = 5e-05 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +1 Query: 646 HWPSFYNVVTGKTLALPNFXRLAAHP 723 HWPSFYNVVTGKTLALPN L P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRP 757 GK P L ALQHIPLSPAGVIAKRP Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIAKRP 98 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 46.8 bits (106), Expect = 5e-05 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +1 Query: 646 HWPSFYNVVTGKTLALPNFXRLAAHP 723 HWPSFYNVVTGKTLALPN L P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 677 GKPWRYPTLXALQHIPLSPAGVIAKRP 757 GK P L ALQHIPLSPAGVIAKRP Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIAKRP 93 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 46.4 bits (105), Expect = 6e-05 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 808 AHSPFKAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTA 650 +HSPF+ GR++ L + KG SWVTPGFSQSRRCKTTA Sbjct: 178 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWEN GVTQL + PF Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPF 541 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 534 RLAAHPPFASWRNSEEA 550 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -1 Query: 808 AHSPFKAXQLLGRAIGXGPLXYYASWRKGDVLQG 707 +HSPF+ G+ GPL YYASWRKGDVLQG Sbjct: 3 SHSPFRLRNC-GKGDRCGPLRYYASWRKGDVLQG 35 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG---*RQGFPSHDVV 661 GR++ GL AITPAGERGMCCKA K+G + G P++ VV Sbjct: 130 GRAIGAGLFAITPAGERGMCCKAIKLGLDVPKHGEPAYPVV 170 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -1 Query: 808 AHSPFKAXQLLGRAIGXGPLXYYASWRKGDVLQG 707 +HSPF+ G+ GPL YYASWRKGDVLQG Sbjct: 3 SHSPFRLRNC-GKGDRCGPLRYYASWRKGDVLQG 35 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 46.4 bits (105), Expect = 6e-05 Identities = 29/55 (52%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Frame = -1 Query: 802 SPF--KAXQLL-GRAIGXGPLXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 +PF +A QLL GR++ L + KG SWVTPGFSQSRRCKTTAS Sbjct: 10 APFAIQAAQLLEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -1 Query: 808 AHSPFKAXQLLGRAIGXGPLXYYASWRKGDVLQG 707 +HSPF+ G+ GPL YYASWRKGDVLQG Sbjct: 3 SHSPFRLRNC-GKGDRCGPLRYYASWRKGDVLQG 35 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 46.0 bits (104), Expect = 8e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +1 Query: 664 NVVTGKTLALPNFXRLAAHPPFASWRNSXE 753 N VTGKT + RLAAHPPFA+WRNS E Sbjct: 8 NDVTGKTPGVTQLNRLAAHPPFANWRNSKE 37 >SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 805 HSPFKAXQLLGRAIGXGPLXYYASWRKGDVLQG 707 HSPF+ G+ GPL YYASWRKGDVLQG Sbjct: 11 HSPFRLRNC-GKGDRCGPLRYYASWRKGDVLQG 42 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 700 SWVTPGFSQSRRCKTTASE 644 SWVTPGFSQSRRCKTTASE Sbjct: 560 SWVTPGFSQSRRCKTTASE 578 Score = 35.9 bits (79), Expect = 0.088 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 773 KGDRXGASXLLRQLAKGGCAARR 705 +G AS LLRQLAKGGCAARR Sbjct: 536 EGRSVRASSLLRQLAKGGCAARR 558 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 45.6 bits (103), Expect = 1e-04 Identities = 21/29 (72%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG*R 688 GR++ GL AITPAGERGMCCKA K+G R Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGIR 42 >SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 1e-04 Identities = 26/53 (49%), Positives = 29/53 (54%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + G +LNGEW Sbjct: 8 LAVVLQRRDWENPGVTQLNRLGAHPPFARWLNSEEGRTD-RPSQQLRSLNGEW 59 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG 694 GR++ GL AITPAGERGMCCKA K+G Sbjct: 1956 GRAIGAGLFAITPAGERGMCCKAIKLG 1982 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 45.2 bits (102), Expect = 1e-04 Identities = 28/60 (46%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFR--QLA**XRGPXPIALPNSCXALNGEWANCKR 821 LAVVLQRRDWENPGVTQL + PF + + R P +LNGEW +R Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP---SQQLRSLNGEWRLMRR 156 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG 694 GR++ GL AITPAGERGMCCKA K+G Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG 694 GR++ GL AITPAGERGMCCKA K+G Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 45.2 bits (102), Expect = 1e-04 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFR--QLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + + R P +LNGEW Sbjct: 220 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRTSEEARTDRP---SQQLRSLNGEW 271 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG 694 GR++ GL AITPAGERGMCCKA K+G Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/43 (53%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -1 Query: 772 RAIGXGP-LXYYASWRKGDVLQGX*SWVTPGFSQSRRCKTTAS 647 +A+G GP + + G SWVTPGFSQSRRCKTTAS Sbjct: 316 KAMGIGPGVQQQFKFTPGGCAARRLSWVTPGFSQSRRCKTTAS 358 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/53 (47%), Positives = 29/53 (54%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + + +LNGEW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFARWRNSQKARTD-RPSQQLRSLNGEW 116 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEKARTD-RPSQQLRSLNGEW 182 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNNEKARTD-RPSQQLRSLNGEW 80 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 771 GRSV-XGLXAITPAGERGMCCKAXKVG 694 GR++ GL AITPAGERGMCCKA K+G Sbjct: 238 GRAIGAGLFAITPAGERGMCCKAIKLG 264 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTD-RPSQQLRSLNGEW 100 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTD-RPSQQLRSLNGEW 98 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTD-RPSQQLRSLNGEW 174 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTD-RPSQQLRSLNGEW 109 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLRSLNGEW 89 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 720 MCCKAXKVG*RQGFPSHDVVKRRPV 646 MCCKA K+G + FPSHDVVKRRPV Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV 25 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 44.8 bits (101), Expect = 2e-04 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQL--A**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + + R P +LNGEW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFARWRNSEEARTDRP---SQQLRSLNGEW 116 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPFRQLA**XRGPXPIALPNSCXALNGEW 806 LAVVLQRRDWENPGVTQL + PF + +LNGEW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLRSLNGEW 116 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 54 RLAAHPPFASWRNSEEA 70 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 81 RLAAHPPFASWRNSEEA 97 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPF 70 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 63 RLAAHPPFASWRNSEEA 79 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 55 RLAAHPPFASWRNSEEA 71 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 81 RLAAHPPFASWRNSEEA 97 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 86 RLAAHPPFASWRNSEEA 102 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 57 RLAAHPPFASWRNSEEA 73 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 77 RLAAHPPFASWRNSEEA 93 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPF 96 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 89 RLAAHPPFASWRNSEEA 105 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 65 RLAAHPPFASWRNSEEA 81 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 54 RLAAHPPFASWRNSEEA 70 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPF 51 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 44 RLAAHPPFASWRNSEEA 60 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 69 RLAAHPPFASWRNSEEA 85 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 78 RLAAHPPFASWRNSEEA 94 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPF 79 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 72 RLAAHPPFASWRNSEEA 88 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF 95 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 88 RLAAHPPFASWRNSEEA 104 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 76 RLAAHPPFASWRNSEEA 92 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 59 RLAAHPPFASWRNSEEA 75 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPF 242 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 235 RLAAHPPFASWRNSEEA 251 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPF 137 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 130 RLAAHPPFASWRNSEEA 146 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 68 RLAAHPPFASWRNSEEA 84 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPF 54 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 47 RLAAHPPFASWRNSEEA 63 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 35 RLAAHPPFASWRNSEEA 51 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPF 73 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 66 RLAAHPPFASWRNSEEA 82 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPF 407 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 400 RLAAHPPFASWRNSEEA 416 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPF 133 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 126 RLAAHPPFASWRNSEEA 142 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPF 109 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 102 RLAAHPPFASWRNSEEA 118 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 58 RLAAHPPFASWRNSEEA 74 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPF 34 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 27 RLAAHPPFASWRNSEEA 43 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF 44 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 37 RLAAHPPFASWRNSEEA 53 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 57 RLAAHPPFASWRNSEEA 73 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPF 129 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 122 RLAAHPPFASWRNSEEA 138 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 64 RLAAHPPFASWRNSEEA 80 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPF 366 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 359 RLAAHPPFASWRNSEEA 375 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPF 106 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 99 RLAAHPPFASWRNSEEA 115 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 69 RLAAHPPFASWRNSEEA 85 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 35 RLAAHPPFASWRNSEEA 51 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 78 RLAAHPPFASWRNSEEA 94 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 62 RLAAHPPFASWRNSEEA 78 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPF 160 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 153 RLAAHPPFASWRNSEEA 169 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 48 RLAAHPPFASWRNSEEA 64 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF 89 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 82 RLAAHPPFASWRNSEEA 98 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 58 RLAAHPPFASWRNSEEA 74 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPF 169 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 162 RLAAHPPFASWRNSEEA 178 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPF 859 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 852 RLAAHPPFASWRNSEEA 868 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF 42 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 35 RLAAHPPFASWRNSEEA 51 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 3e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 648 LAVVLQRRDWENPGVTQLXSPCSTSPF 728 LAVVLQRRDWENPGVTQL + PF Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF 86 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 706 RLAAHPPFASWRNSXEA 756 RLAAHPPFASWRNS EA Sbjct: 79 RLAAHPPFASWRNSEEA 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,073,880 Number of Sequences: 59808 Number of extensions: 648213 Number of successful extensions: 11926 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11663 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5094195218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -