BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_F11_e86_11.seq (1494 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 7.4 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 7.4 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 7.4 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 7.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 397 FYFNPIFFCHLLFSFRPFGFLFNRG 323 ++F +F LL +GFLF+ G Sbjct: 894 YFFTSVFTIELLLKLVSYGFLFHDG 918 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.6 bits (51), Expect = 7.4 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 71 ITVLPFQQGHQ*NQYLPSSTMX-VDKEELVQRAKLAEQAERYDDMAAA 211 + + P QQ H LP T D E+++ +QAE Y DM+ A Sbjct: 636 VMIQPKQQQH--GTGLPLRTQNKTDAEKILSHVHALKQAEGYIDMSCA 681 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.6 bits (51), Expect = 7.4 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +2 Query: 311 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLCLLDKHLIPKASNP 472 W+V+ ++ + K + + +V K C V L+D LI K NP Sbjct: 274 WKVMKDVKDFIKLLLHKAFIVENQPPQVMKMNTRFCASVRLLIDNALIMKIGNP 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 908,411 Number of Sequences: 2352 Number of extensions: 14553 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 174749850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -