BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_F06_e46_12.seq (1519 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 24 3.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 24 3.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 24 3.4 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 129 PIHQNMAPIPISIPAGASLTPVS 197 P+H +M P + + G SLTP++ Sbjct: 366 PMHHDMLPETMHMGMGPSLTPLA 388 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.8 bits (49), Expect = 3.4 Identities = 13/52 (25%), Positives = 20/52 (38%) Frame = +3 Query: 9 WVQPLSPNVSPTIRYQYMYSPYESHKTYQLQAPQYSQPEVPIHQNMAPIPIS 164 W +PT + Q + SP TY A E P+ + +P+S Sbjct: 178 WSATPQAGSTPTYQTQGLLSPSYGGTTYSFTADFRPPQETPVLASYKSVPMS 229 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 129 PIHQNMAPIPISIPAGASLTPVS 197 P+H +M P + + G SLTP++ Sbjct: 366 PMHHDMLPETMHMGMGPSLTPLA 388 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,794 Number of Sequences: 336 Number of extensions: 3815 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45579125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -