BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_F02_e14_12.seq (1593 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03410.1 68416.m00339 calmodulin-related protein, putative si... 29 6.4 At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-conta... 29 8.5 >At3g03410.1 68416.m00339 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 131 Score = 29.5 bits (63), Expect = 6.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 455 TGCINRFLKHIFLFCDI 505 T CI + LK +F+FCD+ Sbjct: 60 TSCIEKMLKEVFVFCDV 76 >At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 884 Score = 29.1 bits (62), Expect = 8.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 634 QNTLSLCSRNTSICIWREVFKLNGSRYPAQALLENTAVLWFPHD 503 ++ L C +WR VFKL +R ++LLEN + W HD Sbjct: 688 EDGLPKCYAKIQQIVWRPVFKLQINRLEPKSLLEN-VIQW--HD 728 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,068,312 Number of Sequences: 28952 Number of extensions: 399687 Number of successful extensions: 754 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4298812032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -