BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_F01_e6_11.seq (1607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 4.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 4.8 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 4.8 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.4 bits (48), Expect = 4.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 234 NSLEDVSSSAALIQQSTTVKNKDIRKFLDGLY 139 N+L S+ AL+ K+ I++FL G+Y Sbjct: 94 NTLNTCRSALALLLSPEVGKDHRIKRFLRGVY 125 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 4.8 Identities = 12/50 (24%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 55 LQXIRHEVQIPYLMVLYLICYNSRLLRYIETVQ-ELSDILVLYCR*LLDQ 201 +Q +R ++ YL+ Y + + L+ IET + E+ D + ++ +L++ Sbjct: 1020 IQEVRAKIYFFYLVKFYKVSKSGELIHKIETNEHEIIDKIEMFSLQILNE 1069 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.4 bits (48), Expect = 4.8 Identities = 12/50 (24%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 55 LQXIRHEVQIPYLMVLYLICYNSRLLRYIETVQ-ELSDILVLYCR*LLDQ 201 +Q +R ++ YL+ Y + + L+ IET + E+ D + ++ +L++ Sbjct: 301 IQEVRAKIYFFYLVKFYKVSKSGELIHKIETNEHEIIDKIEMFSLQILNE 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 284,533 Number of Sequences: 336 Number of extensions: 5398 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48651875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -