BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E11_e85_09.seq (1515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 32 0.050 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 28 0.81 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 27 1.4 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 31.9 bits (69), Expect = 0.050 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 140 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQ-----VGKVPAASLPHVLRWYSHIAS 304 K +G+ + YL + YV+G + AD +F + K + P+V RW++ + + Sbjct: 127 KVKRGVEIVEMYLTDSPYVAGQKLTIADFSIFVSFCSLDMMKYDLTAYPNVQRWFAKMGT 186 Query: 305 YTP 313 + P Sbjct: 187 HIP 189 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 27.9 bits (59), Expect = 0.81 Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = +2 Query: 140 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQVGKVPAASL-----PHVLRWYSHIAS 304 K + LN +L YV+G + + AD+ + + A HV WY +I Sbjct: 129 KMKDAVGFLNSFLDGHKYVAGDSLTIADLSILATISTYDVAGFDLAKYQHVAAWYENIRK 188 Query: 305 YTP 313 P Sbjct: 189 EAP 191 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 27.1 bits (57), Expect = 1.4 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 5/63 (7%) Frame = +2 Query: 140 KTAQGLNELNQYLAERSYVSGYTPSQADIKVFEQVGKVPAASL-----PHVLRWYSHIAS 304 K ++ LN +L YV+G + + AD+ + + A HV WY +I Sbjct: 129 KMKDAVDFLNTFLDGHKYVAGDSLTIADLSILATISTYDVAGFDLAKYQHVAVWYENIRK 188 Query: 305 YTP 313 P Sbjct: 189 EAP 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,088,121 Number of Sequences: 2352 Number of extensions: 18833 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177594615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -