BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E10_e77_10.seq (1509 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharo... 28 2.9 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 27 6.7 >SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 670 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 242 NFR*KKTS*ENHSMVVGHFLMMTAWVATTLKFENLLPNT 358 NF+ +T EN +M + +++A FEN LPNT Sbjct: 308 NFQRAQTKIENDNMPLNRPYVLSATARNESSFENTLPNT 346 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 27.1 bits (57), Expect = 6.7 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +3 Query: 1389 PXGPXEXXGPPPFGXXPAXXXPKXRPXXPP 1478 P P E PPP P +P PP Sbjct: 412 PARPTESPPPPPISSSSTTPRPDDKPSLPP 441 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,859,704 Number of Sequences: 5004 Number of extensions: 90064 Number of successful extensions: 170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 844406124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -