BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E10_e77_10.seq (1509 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58468| Best HMM Match : rve (HMM E-Value=1.2e-11) 31 2.4 SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) 29 9.7 >SB_58468| Best HMM Match : rve (HMM E-Value=1.2e-11) Length = 257 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 695 SLTKLLLSHQYSSSVYLENKNDNEYIRKL 781 +L++ L SHQY+ + LEN+ E++++L Sbjct: 103 TLSERLYSHQYAQEMLLENERSREWVKRL 131 >SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) Length = 416 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/75 (20%), Positives = 38/75 (50%) Frame = +2 Query: 521 TKSLVLYYHHWDSDTEVDVCEHHFMSYETEI*LLVLRFTVINKLSSINLNAVSWRQPGSL 700 + S+++ +HH S + + + HH S + ++++ + SS ++ + P S Sbjct: 56 SSSIIIIHHHHPSSSSIIIIHHHHPSSSS---IIIIHH---HHPSSSSIIIIHHHHPSSS 109 Query: 701 TKLLLSHQYSSSVYL 745 + +++ H SSS+ + Sbjct: 110 SIIIIHHHPSSSIII 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,731,659 Number of Sequences: 59808 Number of extensions: 716974 Number of successful extensions: 1468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1442 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4894653009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -