BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E10_e77_10.seq (1509 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 27 0.42 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 25 1.3 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 27.1 bits (57), Expect = 0.42 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +2 Query: 215 HLSNSKIGLNFR*KKTS*ENHSMVVGHFLMMTAWVATTLKFENLLPNTNRC 367 H + +I T ENH +G+ + WV LK ++L N C Sbjct: 83 HSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKEKHLTQRINSC 133 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 75 HEXLFSHLRVSLKSKMRDH*VLHLVNCDDGPVSSAAGFRVNRRWFDP 215 H+ L +HLR +L + +L L + D+ + F + ++W+DP Sbjct: 126 HQHLRTHLRGTLTVNVSVL-LLSLASPDESSLKYEVEFLLQQQWYDP 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 355,673 Number of Sequences: 438 Number of extensions: 7269 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52754625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -