BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E07_e53_09.seq (1551 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q14NU4 Cluster: Putative trna pseudouridine synthase b ... 35 6.6 >UniRef50_Q14NU4 Cluster: Putative trna pseudouridine synthase b protein; n=1; Spiroplasma citri|Rep: Putative trna pseudouridine synthase b protein - Spiroplasma citri Length = 303 Score = 34.7 bits (76), Expect = 6.6 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +3 Query: 147 IKGQDITLKSFRTKFYNNHELFIFFSAFCTFKTIILNLLVQYKFKFKKVIN*RLFC--LH 320 IK + +T+K+ + K Y+ H I FS CT T I +L+ K + C Sbjct: 141 IKPRTVTIKAIKLKKYDAHNHTIKFSVLCTKGTYIRSLVTDIAAKLNTIATVTALCRTQS 200 Query: 321 GETIKTKSIQW*KPPPISFSSL 386 G + +K+I P ++F+ L Sbjct: 201 GNFLLSKAI---SPETVNFNEL 219 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,386,041 Number of Sequences: 1657284 Number of extensions: 11904363 Number of successful extensions: 18604 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18600 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 166151143700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -