BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E05_e37_09.seq (1513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 99 8e-21 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 93 5e-19 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-18 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 90 5e-18 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 89 9e-18 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 1e-17 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 87 3e-17 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 87 3e-17 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 87 3e-17 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 87 3e-17 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 87 3e-17 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 87 5e-17 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 87 5e-17 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 87 5e-17 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 87 5e-17 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 87 5e-17 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 87 5e-17 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 87 5e-17 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 87 5e-17 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 87 5e-17 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 87 5e-17 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 87 5e-17 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 87 5e-17 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 87 5e-17 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 87 5e-17 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 87 5e-17 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 87 5e-17 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 87 5e-17 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 87 5e-17 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 87 5e-17 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 87 5e-17 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 87 5e-17 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 87 5e-17 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 87 5e-17 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 87 5e-17 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 87 5e-17 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 87 5e-17 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 87 5e-17 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 87 5e-17 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 87 5e-17 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 87 5e-17 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 87 5e-17 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 87 5e-17 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 87 5e-17 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 87 5e-17 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 87 5e-17 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 87 5e-17 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 87 5e-17 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 87 5e-17 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 87 5e-17 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 87 5e-17 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 87 5e-17 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 87 5e-17 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 87 5e-17 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 87 5e-17 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-17 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 86 8e-17 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 86 8e-17 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 85 1e-16 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 85 1e-16 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 85 1e-16 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 85 1e-16 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 85 1e-16 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 85 1e-16 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 85 1e-16 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 85 1e-16 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 85 1e-16 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 85 1e-16 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 85 1e-16 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 85 1e-16 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 85 1e-16 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 85 1e-16 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 85 1e-16 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 85 1e-16 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 85 1e-16 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 85 1e-16 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 85 1e-16 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 85 1e-16 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 85 1e-16 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 85 1e-16 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 85 1e-16 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 85 1e-16 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 85 1e-16 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 85 1e-16 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 85 1e-16 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 85 1e-16 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 85 1e-16 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 85 1e-16 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 85 1e-16 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 85 1e-16 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 85 1e-16 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 85 1e-16 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 85 1e-16 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 99.1 bits (236), Expect = 8e-21 Identities = 45/56 (80%), Positives = 46/56 (82%) Frame = +2 Query: 563 LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVIAKRPAPIRPSXQLRXLNGEW 730 + HWPSFYNVVTGKTLA P L ALQHIPLSPAGVIAKRPAPI QLR LNGEW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 93.1 bits (221), Expect = 5e-19 Identities = 43/78 (55%), Positives = 53/78 (67%), Gaps = 2/78 (2%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSPFPXVAX- 714 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P + Sbjct: 41 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 100 Query: 715 -PEWXMANCKR*YSGKIR 765 EW + C + Y+ ++R Sbjct: 101 NGEWRLMRCGQNYTTRLR 118 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 91.1 bits (216), Expect = 2e-18 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +1 Query: 520 RGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 RGG P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 101 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 100 RPSQQLRSLNGEWRLM 115 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 89.8 bits (213), Expect = 5e-18 Identities = 40/59 (67%), Positives = 45/59 (76%) Frame = +1 Query: 520 RGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 +GG P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 89.4 bits (212), Expect = 6e-18 Identities = 41/71 (57%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSPFPXVAX- 714 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P + Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 217 Query: 715 -PEWXMANCKR 744 EW + C + Sbjct: 218 NGEWRLMRCDK 228 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNILVKFAXNFLLI 784 RPS QLR LNGEW+++ + F LLI Sbjct: 209 RPSQQLRSLNGEWRLMRCDKSFIFREVLLLI 239 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 89.4 bits (212), Expect = 6e-18 Identities = 41/56 (73%), Positives = 43/56 (76%) Frame = +2 Query: 563 LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVIAKRPAPIRPSXQLRXLNGEW 730 + HW SFYNVVTGKTLA P L ALQHIPLSPAGVIA+ RPS QLR LNGEW Sbjct: 40 ITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 89.0 bits (211), Expect = 9e-18 Identities = 40/58 (68%), Positives = 44/58 (75%) Frame = +1 Query: 523 GGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 G +YP +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNILVKFAXNFLLISXFFTP*XGIGXXLFNQXNSTGIGL 859 RPS QLR LNGEW+++ +L + + FT + + G+G+ Sbjct: 73 RPSQQLRSLNGEWRLMRYFLLTHLCASTEIPRSTFTQASSVQRLFGTSQDDAGVGV 128 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 88.6 bits (210), Expect = 1e-17 Identities = 40/56 (71%), Positives = 43/56 (76%) Frame = +2 Query: 563 LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVIAKRPAPIRPSXQLRXLNGEW 730 + HWPSFYNVVTGKTLA P L ALQHIPLSPAGV ++ RPS QLR LNGEW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 88.2 bits (209), Expect = 1e-17 Identities = 40/58 (68%), Positives = 44/58 (75%) Frame = +1 Query: 523 GGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 G A P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 95 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 94 RPSQQLRSLNGEWRLMRYFLL 114 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 88.2 bits (209), Expect = 1e-17 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = +1 Query: 553 VSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 +SRIT SLAVVLQRRDWEN GV L RLAAHPPFASWRNSEEARTD P Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRP 135 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 134 RPSQQLRSLNGEWRLMRDFLL 154 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 87.8 bits (208), Expect = 2e-17 Identities = 40/60 (66%), Positives = 44/60 (73%) Frame = +1 Query: 517 TRGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 TR P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 54 TREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 87.8 bits (208), Expect = 2e-17 Identities = 40/60 (66%), Positives = 44/60 (73%) Frame = +1 Query: 517 TRGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 TR P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 87.8 bits (208), Expect = 2e-17 Identities = 40/62 (64%), Positives = 47/62 (75%) Frame = +2 Query: 569 FHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVIAKRPAPIRPSXQLRXLNGEWQIVSXN 748 +HWPSFYNVVTGKTLA P L ALQHIPLSPAG ++ RPS QLR LNGEW+++ Sbjct: 4 WHWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLMRNF 63 Query: 749 IL 754 +L Sbjct: 64 LL 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 87.4 bits (207), Expect = 3e-17 Identities = 40/59 (67%), Positives = 44/59 (74%) Frame = +1 Query: 520 RGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 RG P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 59 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 58 RPSQQLRSLNGEWRLM 73 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 87.4 bits (207), Expect = 3e-17 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +1 Query: 520 RGGARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 RGG P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 140 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 139 RPSQQLRSLNGEWRLMRYFLL 159 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 87.4 bits (207), Expect = 3e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 532 RYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 R P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 148 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 147 RPSQQLRSLNGEWRLMRYFLL 167 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 87.4 bits (207), Expect = 3e-17 Identities = 42/73 (57%), Positives = 48/73 (65%), Gaps = 2/73 (2%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSPFPXVAX- 714 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P + Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 238 Query: 715 -PEWXMANCKR*Y 750 EW + R Y Sbjct: 239 NGEWRLMRYMRDY 251 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 87.4 bits (207), Expect = 3e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 532 RYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 R P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 111 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 110 RPSQQLRSLNGEWRLMRYFLL 130 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 87.4 bits (207), Expect = 3e-17 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = +1 Query: 565 TISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSPFPXVAX--PEWXMANC 738 +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P + EW + Sbjct: 48 SLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRT 107 Query: 739 KR 744 KR Sbjct: 108 KR 109 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 87.4 bits (207), Expect = 3e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 532 RYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 R P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 61 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 60 RPSQQLRSLNGEWRLMRYFLL 80 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 87.4 bits (207), Expect = 3e-17 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 532 RYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 R P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 64 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 63 RPSQQLRSLNGEWRLM 78 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 87.0 bits (206), Expect = 3e-17 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 526 GARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 G P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 144 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 143 RPSQQLRSLNGEWRLMRYFLL 163 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 87.0 bits (206), Expect = 3e-17 Identities = 44/61 (72%), Positives = 45/61 (73%), Gaps = 4/61 (6%) Frame = +1 Query: 526 GARYPIRPIVSRITIS----LAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDS 693 G YP P SR + S LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 101 Query: 694 P 696 P Sbjct: 102 P 102 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 87.0 bits (206), Expect = 3e-17 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 526 GARYPIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 G P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 759 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 758 RPSQQLRSLNGEWRLMRYFLL 778 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 65 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 64 RPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 89 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 68 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 67 RPSQQLRSLNGEWRLMRYFLL 87 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 68 RPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 58 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 873 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 872 RPSQQLRSLNGEWRLMRYFLL 892 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 154 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 153 RPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 128 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 76 RPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 172 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 171 RPSQQLRSLNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 193 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 192 RPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 61 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 60 RPSQQLRSLNGEWRLM 75 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 99 RPSQQLRSLNGEWRLMRYFLL 119 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 73 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 72 RPSQQLRSLNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 88 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 87 RPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 80 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 79 RPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 115 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 114 RPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 140 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNILVK 760 RPS QLR LNGEW+++ + K Sbjct: 139 RPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 68 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 67 RPSQQLRSLNGEWRLMRYFLL 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 186 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 185 RPSQQLRSLNGEWRLM 200 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 99 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 98 RPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 128 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 1230 Score = 49.2 bits (112), Expect = 8e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 698 KGESVRASSLLRQLAKGGCAARRXXW 621 +G SVRASSLLRQLAKGGCAARR W Sbjct: 414 EGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 729 HSPFRXRNXWEGR 691 HSPFR RN WEGR Sbjct: 404 HSPFRLRNCWEGR 416 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 1229 RPSQQLRSLNGEWRLM 1244 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 72 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 71 RPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 165 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 164 RPSQQLRSLNGEWRLMRYFLL 184 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 117 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 116 RPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 71 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 70 RPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 73 RPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 75 RPSQQLRSLNGEWRLM 90 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 136 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 135 RPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 101 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 100 RPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 124 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 80 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 79 RPSQQLRSLNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 124 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 124 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 61 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 60 RPSQQLRSLNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 105 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 104 RPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 64 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 64 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 83 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 82 RPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 116 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 115 RPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 107 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 106 RPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 131 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 130 RPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 81 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 80 RPSQQLRSLNGEWRLMRYFLL 100 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 1103 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXN 748 RPS QLR LNGEW+++ N Sbjct: 1102 RPSQQLRSLNGEWRLMRQN 1120 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 56 RPSQQLRSLNGEWRLM 71 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 71 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 70 RPSQQLRSLNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 174 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 173 RPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 222 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 221 RPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 99 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 98 RPSQQLRSLNGEWRLMRYFLL 118 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 59 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 58 RPSQQLRSLNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 186 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 185 RPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 97 RPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 156 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 155 RPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 63 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 62 RPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 692 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 691 RPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 201 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 200 RPSQQLRSLNGEWRLMRYFLL 220 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 87 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 86 RPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 72 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 71 RPSQQLRSLNGEWRLM 86 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 97 RPSQQLRSLNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 110 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 109 RPSQQLRSLNGEWRLMRYFLL 129 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 56 RPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 Score = 46.4 bits (105), Expect = 6e-05 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 631 RLAAHPPFASWRNSEEARTDSP 696 +++AHPPFASWRNSEEARTD P Sbjct: 14 QVSAHPPFASWRNSEEARTDRP 35 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 99 RPSQQLRSLNGEWRLM 114 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 111 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 110 RPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 119 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 118 RPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 225 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 224 RPSQQLRSLNGEWRLMRYFLL 244 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 306 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 305 RPSQQLRSLNGEWRLMRYFLL 325 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 73 RPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 110 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 109 RPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 144 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 143 RPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 103 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 102 RPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 56 RPSQQLRSLNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 114 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 113 RPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 123 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 122 RPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 216 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 215 RPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 71 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 70 RPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 123 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 122 RPSQQLRSLNGEWRLMRYFLL 142 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 89 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 113 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 112 RPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 182 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 181 RPSQQLRSLNGEWRLM 196 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 68 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 108 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 107 RPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 77 RPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 84 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 83 RPSQQLRSLNGEWRLMRYFLL 103 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 78 RPSQQLRTLNGEWRLM 93 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 121 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 127 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 126 RPSQQLRSLNGEWRLMRYFLL 146 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 77 RPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 90 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 89 RPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 89 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 81 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 80 RPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 62 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 61 RPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 166 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 165 RPSQQLRSLNGEWRLMRYFLL 185 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 83 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 82 RPSQQLRSLNGEWRLM 97 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 58 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 94 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 93 RPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 128 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 95 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 94 RPSQQLRSLNGEWRLMRYFLL 114 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 97 RPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 134 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 133 RPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 105 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 104 RPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 207 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 206 RPSQQLRSLNGEWRLMRYFLL 226 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 101 RPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 82 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 81 RPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 56 RPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 73 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 72 RPSQQLRSLNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 119 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 118 RPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 73 RPSQQLRSLNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 145 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 144 RPSQQLRSLNGEWRLMRYFLL 164 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 86 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 85 RPSQQLRSLNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 75 RPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 159 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 158 RPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 192 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 191 RPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 142 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 141 RPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 73 RPSQQLRSLNGEWRLMRYFLL 93 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 66 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 65 RPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 95 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 94 RPSQQLRSLNGEWRLM 109 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 76 RPSQQLRSLNGEWRLMRYFLL 96 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 96 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 95 RPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 196 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 195 RPSQQLRSLNGEWRLM 210 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 166 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 165 RPSQQLRSLNGEWRLMRYFLL 185 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 97 RPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 129 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 128 RPSQQLRSLNGEWRLM 143 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 59 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 58 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 66 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNILVKFAXNFLLISXFF 796 RPS QLR LNGEW+++ +L L++ + Sbjct: 65 RPSQQLRSLNGEWRLMRYFLLTHLCAFVLILGKIY 99 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 125 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 124 RPSQQLRSLNGEWRLMRYFLL 144 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 84 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 83 RPSQQLRSLNGEWRLM 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 133 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 132 RPSQQLRSLNGEWRLMRYFLL 152 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 179 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 185 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 184 RPSQQLRSLNGEWRLM 199 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 112 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 111 RPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 133 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 132 RPSQQLRSLNGEWRLMRYFLL 152 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 95 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 94 RPSQQLRSLNGEWRLM 109 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 147 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 146 RPSQQLRSLNGEWRLMRYFLL 166 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 121 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 148 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 147 RPSQQLRSLNGEWRLMRYFLL 167 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 346 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 345 RPSQQLRSLNGEWRLMRYFLL 365 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 103 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 70 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 69 RPSQQLRSLNGEWRLM 84 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 92 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 91 RPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 55 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 54 RPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 66 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 65 RPSQQLRSLNGEWRLMRYFLL 85 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 96 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 95 RPSQQLRSLNGEWRLMRYFLL 115 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 65 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 287 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 286 RPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 121 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 88 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 87 RPSQQLRSLNGEWRLMRYFLL 107 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 64 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 192 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 244 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 243 RPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 103 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 102 RPSQQLRSLNGEWRLMRYFLL 122 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 58 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 74 RPSQQLRSLNGEWRLM 89 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 569 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 568 RPSQQLRSLNGEWRLM 583 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 76 RPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 59 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 70 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 69 RPSQQLRSLNGEWRLMRYFLL 89 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 5e-17 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +1 Query: 541 IRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 IRPIVSRITI +RRDWENPGV L RLAAHPPFASWR+SEEARTD P Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRP 69 Score = 37.5 bits (83), Expect = 0.028 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 497 PXXXXXXLEGGPGTQFAL**VV--LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVI 670 P + G + A+ +V + HWPSFY + L L P + Sbjct: 1 PGGSTSSIAAGIAVELAIRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRS 60 Query: 671 AKRPAPIRPSXQLRXLNGEW 730 ++ RPS QLR LNGEW Sbjct: 61 SEEARTDRPSQQLRRLNGEW 80 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 59 RPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 125 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 124 RPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 72 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 71 RPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 149 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 148 RPSQQLRSLNGEWRLMRYFLL 168 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 86.6 bits (205), Expect = 5e-17 Identities = 39/56 (69%), Positives = 42/56 (75%) Frame = +2 Query: 563 LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVIAKRPAPIRPSXQLRXLNGEW 730 + HWPSFYNVVTGKTLA P L ALQHIPLSPAG+ + RPS QLR LNGEW Sbjct: 82 ITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 61 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 60 RPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 76 RPSQQLRSLNGEWRLMRYFLL 96 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 81 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 238 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 237 RPSQQLRSLNGEWRLM 252 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 99 RPSQQLRSLNGEWRLMRYFLL 119 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 66 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 67 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 66 RPSQQLRSLNGEWRLM 81 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 107 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 106 RPSQQLRSLNGEWRLMRYFLL 126 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 84 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 83 RPSQQLRSLNGEWRLMRYFLL 103 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 80 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 79 RPSQQLRSLNGEWRLM 94 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 60 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 109 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 161 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 160 RPSQQLRSLNGEWRLMRYFLL 180 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 352 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 404 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNILVKFAXNF 775 RPS QLR LNGEW+++ +L ++ Sbjct: 403 RPSQQLRSLNGEWRLMRYFLLTHLCADW 430 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 81 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 80 RPSQQLRSLNGEWRLMRYFLL 100 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 75 RPSQQLRSLNGEWRLM 90 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 94 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIVSXNIL 754 RPS QLR LNGEW+++ +L Sbjct: 93 RPSQQLRSLNGEWRLMRYFLL 113 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 56 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 121 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 692 RPSXQLRXLNGEWQIV 739 RPS QLR LNGEW+++ Sbjct: 120 RPSQQLRSLNGEWRLM 135 >SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 538 PIRPIVSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 P+ +++LAVVLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 71 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 85.8 bits (203), Expect = 8e-17 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = -3 Query: 722 HSGXATXGKGESVRASSLLRQLAKGGCAARRXXWXTPGFSQSRRCKTTASEI 567 +SG +G SVRASSLLRQLAKGGCAARR W TPGFSQSRRCKTTASE+ Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 85.8 bits (203), Expect = 8e-17 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 701 GKGESVRASSLLRQLAKGGCAARRXXWXTPGFSQSRRCKTTASEI 567 G+G SVRASSLLRQLAKGGCAARR W TPGFSQSRRCKTTASE+ Sbjct: 54 GEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 85.4 bits (202), Expect = 1e-16 Identities = 39/48 (81%), Positives = 40/48 (83%) Frame = +1 Query: 553 VSRITISLAVVLQRRDWENPGVXXLXRLAAHPPFASWRNSEEARTDSP 696 +SRITI VLQRRDWENPGV L RLAAHPPFASWRNSEEARTD P Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 324 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = +2 Query: 563 LQFHWPSFYNVVTGKTLAXPXLXALQHIPLSPAGVI---AKRPAPIRPSXQLRXLNGEW 730 + HWPS V+ + P + L + P ++ RPS QLR LNGEW Sbjct: 280 ITIHWPS---VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 335 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,674,577 Number of Sequences: 59808 Number of extensions: 558274 Number of successful extensions: 10311 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10261 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4906390786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -