BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E02_e13_10.seq (1418 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 24 2.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 9.6 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 24.2 bits (50), Expect = 2.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 358 SYEYLKTLASDVHVVRGDFDE 420 S E +TL SD+++++ +FDE Sbjct: 22 SEETCETLMSDINLIKEEFDE 42 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 9.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 558 KDINIELPLHQCQGLL-VTPGHNXMTMNEANTKLPNCYHLLLRVCCIL 418 KDI PL + + +TP ++ T + L CY LL V IL Sbjct: 10 KDIVFINPLVKYLNIFFITPWYDFPTNQKYYPSLAKCYACLLMVVKIL 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,421 Number of Sequences: 336 Number of extensions: 4559 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 42199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -