BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_E02_e13_10.seq (1418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.034 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.14 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.14 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.24 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.32 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.32 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.97 SB_4676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.97 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.97 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.2 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.2 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.9 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 31 2.9 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.9 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.9 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.9 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 3.9 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 30 3.9 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_41436| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 30 5.1 SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 30 5.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 30 5.1 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 30 5.1 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.1 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_29882| Best HMM Match : TraL (HMM E-Value=1.2) 29 6.8 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 29 6.8 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 6.8 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 29 6.8 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 29 9.0 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 29 9.0 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.0 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 29 9.0 >SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 65 RIPAARGIH*XLERPPPR 12 RIPAARGIH LERPPPR Sbjct: 12 RIPAARGIHYVLERPPPR 29 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.14 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 +++ P ++LR NSCSPGDPLV Sbjct: 11 EFLSNPPKNLRSNSCSPGDPLV 32 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.14 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -3 Query: 108 HK*KYIFKPQQSLRPNSCSPGDPLV 34 H K FKP + L NSCSPGDPLV Sbjct: 15 HDTKAPFKPGKHLPSNSCSPGDPLV 39 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.3 bits (75), Expect = 0.24 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 108 HK*KYIFKPQQSLRPNSCSPGDPLV 34 HK +F P + NSCSPGDPLV Sbjct: 25 HKLNTLFIPSTQMASNSCSPGDPLV 49 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.32 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -3 Query: 90 FKPQQSLRPNSCSPGDPLVXRAA 22 F P LR NSCSPGDPLV A Sbjct: 8 FLPLPCLRSNSCSPGDPLVLERA 30 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.32 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 Q+S+R NSCSPGDPLV Sbjct: 31 QESIRSNSCSPGDPLV 46 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.42 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P++S R NSCSPGDPLV Sbjct: 3 PEKSRRSNSCSPGDPLV 19 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.3 bits (70), Expect = 0.97 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 93 IFKPQQSLRPNSCSPGDPLV 34 I+K ++ R NSCSPGDPLV Sbjct: 31 IWKNHKNYRSNSCSPGDPLV 50 >SB_4676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 32.3 bits (70), Expect = 0.97 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 104 NKNISLNHNNPXGRIPAARGIH 39 N N + N+NN RIPAARGIH Sbjct: 50 NNNNNNNNNNNNNRIPAARGIH 71 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.97 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -3 Query: 108 HK*KYIFKPQQSLRP---NSCSPGDPLV 34 H KY F+P + RP NSCSPGDPLV Sbjct: 3 HVKKY-FEPDSNQRPRESNSCSPGDPLV 29 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 K IF + L NSCSPGDPLV Sbjct: 8 KSIFCQMEVLASNSCSPGDPLV 29 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 ++LR NSCSPGDPLV Sbjct: 12 RTLRSNSCSPGDPLV 26 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.1 bits (67), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 93 IFKPQQSLRPNSCSPGDPLV 34 I P+ L NSCSPGDPLV Sbjct: 19 ILSPRARLVSNSCSPGDPLV 38 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 +P ++ NSCSPGDPLV Sbjct: 32 RPYDNIASNSCSPGDPLV 49 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 30.7 bits (66), Expect = 2.9 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 35 TSGSPGLQEFGRRDCCG 85 TSGSPGLQEF R C G Sbjct: 14 TSGSPGLQEFDMRKCKG 30 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 2.9 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P++ R NSCSPGDPLV Sbjct: 12 PKRPHRSNSCSPGDPLV 28 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 2.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 93 IFKPQQSLRPNSCSPGDPLV 34 +F + +R NSCSPGDPLV Sbjct: 47 LFIENRLMRSNSCSPGDPLV 66 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 2.9 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 96 YIFKPQQSLRPNSCSPGDPLV 34 Y F + L NSCSPGDPLV Sbjct: 3 YPFSTEVYLASNSCSPGDPLV 23 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 LR NSCSPGDPLV Sbjct: 2 LRSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P+ R NSCSPGDPLV Sbjct: 376 PRVDRRSNSCSPGDPLV 392 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 96 YIFKPQQSLRPNSCSPGDPLV 34 Y + ++ NSCSPGDPLV Sbjct: 13 YFLRNSSNISSNSCSPGDPLV 33 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 90 FKPQQSLRPNSCSPGDPLV 34 F+ Q + NSCSPGDPLV Sbjct: 16 FQSQTRVTSNSCSPGDPLV 34 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 S R NSCSPGDPLV Sbjct: 18 SFRSNSCSPGDPLV 31 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 30.3 bits (65), Expect = 3.9 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 36 LVDPPGCRNSAXGXXXXXXXXXXXXXXXXXKS-INAINSGRSNII 167 LVDPPGCRNS G KS +AI S ++ I+ Sbjct: 32 LVDPPGCRNSIDGNGVSDGDGGSGDNDNHRKSDSSAIKSSQTEIV 76 >SB_41436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 3.9 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = -1 Query: 230 NILECNINNXGL*STNXLHAKNNITPTGVYRIYRFYRNCXYINKNI-----SLNHNN 75 NI N NN + + N ++KNNI Y+ + Y+N IN I S+N+NN Sbjct: 29 NITNNNNNNNIIINNNNDNSKNNIKKHKAYQKHGHYQNNININSEIKDTKDSINNNN 85 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 + +R NSCSPGDPLV Sbjct: 7 EDEIRSNSCSPGDPLV 22 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 LR NSCSPGDPLV Sbjct: 213 LRSNSCSPGDPLV 225 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 3.9 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 LR NSCSPGDPLV Sbjct: 4 LRSNSCSPGDPLV 16 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 K Q+ + NSCSPGDPLV Sbjct: 114 KNQKEIISNSCSPGDPLV 131 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 KY K + NSCSPGDPLV Sbjct: 4 KYDLKGEAVSSSNSCSPGDPLV 25 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 +S R NSCSPGDPLV Sbjct: 23 KSKRSNSCSPGDPLV 37 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 Q R NSCSPGDPLV Sbjct: 89 QHARSNSCSPGDPLV 103 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 +P+ S NSCSPGDPLV Sbjct: 2 RPEGSHPSNSCSPGDPLV 19 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P +S NSCSPGDPLV Sbjct: 5 PLESYPSNSCSPGDPLV 21 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 Q L NSCSPGDPLV Sbjct: 9 QELTSNSCSPGDPLV 23 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 5.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 ++R NSCSPGDPLV Sbjct: 12 NIRSNSCSPGDPLV 25 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 +SL NSCSPGDPLV Sbjct: 13 KSLTSNSCSPGDPLV 27 >SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 1234 Score = 29.9 bits (64), Expect = 5.1 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +1 Query: 487 HXVVPWGDEESLALVQRQLDVDILISGHTHRFEAYEHENKFYINPGSATGAYSPL 651 H + WGD + R+ +DIL HTH+ + + Y N TG YSP+ Sbjct: 1017 HGTIMWGDRVVVLPKLRRRVLDILHESHTHKLDRFLFA---YRNAPHPTG-YSPV 1067 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -3 Query: 99 KYIFKPQQSLR--PNSCSPGDPLV 34 +YIF SL+ NSCSPGDPLV Sbjct: 650 QYIFAILNSLQLASNSCSPGDPLV 673 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P S NSCSPGDPLV Sbjct: 510 PSSSTPSNSCSPGDPLV 526 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 5.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 +P+ NSCSPGDPLV Sbjct: 27 RPENKALSNSCSPGDPLV 44 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 ++S+ NSCSPGDPLV Sbjct: 108 KRSVESNSCSPGDPLV 123 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 ++R NSCSPGDPLV Sbjct: 11 AVRSNSCSPGDPLV 24 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 +P + + NSCSPGDPLV Sbjct: 17 RPSVASQSNSCSPGDPLV 34 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 63 NSCSPGDPLVXRAAA 19 NSCSPGDPLV AA Sbjct: 56 NSCSPGDPLVLERAA 70 >SB_29882| Best HMM Match : TraL (HMM E-Value=1.2) Length = 142 Score = 29.5 bits (63), Expect = 6.8 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = -1 Query: 218 CNINNXGL*STNXLHAKNNITPTGVYRIYRFY--RNC-XYINKNISLNHNNPXGRIPAAR 48 CN GL + A P+ RI F RN ++++ S+ +P RIPAAR Sbjct: 80 CNPYLYGLLNGEFKRAVRRSLPSFKSRIRPFQVPRNSVSFVSRRASVLSPSPKHRIPAAR 139 Query: 47 GIH 39 GIH Sbjct: 140 GIH 142 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 +R NSCSPGDPLV Sbjct: 3 IRSNSCSPGDPLV 15 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 +Q + NSCSPGDPLV Sbjct: 79 RQQMASNSCSPGDPLV 94 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 +P + L NSCSPGDPLV Sbjct: 12 RPGRLLVSNSCSPGDPLV 29 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 Q+ R NSCSPGDPLV Sbjct: 62 QRQGRSNSCSPGDPLV 77 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 SL NSCSPGDPLV Sbjct: 3 SLSSNSCSPGDPLV 16 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 90 FKPQQSLRPNSCSPGDPLV 34 F+ S + NSCSPGDPLV Sbjct: 4 FEGSLSYQSNSCSPGDPLV 22 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.5 bits (63), Expect = 6.8 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +2 Query: 35 TSGSPGLQEFGRRDCCGLKIYFYLCXYNY-DKIYKCDKL 148 TSGSPGLQEF +R C ++ Y +NY D++ D L Sbjct: 14 TSGSPGLQEFDKRAECPELLHPY---WNYRDELTVADGL 49 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P + + NSCSPGDPLV Sbjct: 30 PNATAQSNSCSPGDPLV 46 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 29.5 bits (63), Expect = 6.8 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 K IFKP NSCSPGDPLV Sbjct: 41 KPIFKPTS----NSCSPGDPLV 58 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 6.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 96 YIFKPQQSLRPNSCSPGDPLV 34 ++F P S NSCSPGDPLV Sbjct: 20 FVFDPNTS---NSCSPGDPLV 37 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 6.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 SL NSCSPGDPLV Sbjct: 5 SLSSNSCSPGDPLV 18 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 6.8 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 93 IFKPQQSLRPNSCSPGDPLV 34 + + ++++ NSCSPGDPLV Sbjct: 16 VVRSRKTISSNSCSPGDPLV 35 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 6.8 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P++S R NSCSPGDPLV Sbjct: 3 PKKS-RSNSCSPGDPLV 18 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 +R NSCSPGDPLV Sbjct: 13 IRSNSCSPGDPLV 25 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 36 LVDPPGCRNSAXG 74 LVDPPGCRNS G Sbjct: 91 LVDPPGCRNSIAG 103 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 ++++ Q + NSCSPGDPLV Sbjct: 18 EFVYTVIQKVVSNSCSPGDPLV 39 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 36 LVDPPGCRNSAXG 74 LVDPPGCRNS G Sbjct: 102 LVDPPGCRNSITG 114 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 6.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 99 KYIFKPQQSLRPNSCSPGDPLV 34 + + + Q + NSCSPGDPLV Sbjct: 6 RLLLQTYQRVESNSCSPGDPLV 27 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 36 LVDPPGCRNSAXG 74 LVDPPGCRNS G Sbjct: 15 LVDPPGCRNSMIG 27 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 87 KPQQSLRPNSCSPGDPLV 34 K ++ + NSCSPGDPLV Sbjct: 14 KTRKKIPSNSCSPGDPLV 31 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 Q+ + NSCSPGDPLV Sbjct: 19 QARKSNSCSPGDPLV 33 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 84 PQQSLRPNSCSPGDPLV 34 P + + NSCSPGDPLV Sbjct: 51 PLEPILSNSCSPGDPLV 67 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.1 bits (62), Expect = 9.0 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 96 YIFKPQQSLRPNSCSPGDPLV 34 +I Q R NSCSPGDPLV Sbjct: 60 FILILQPHPRSNSCSPGDPLV 80 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 9.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 75 SLRPNSCSPGDPLV 34 S R NSCSPGDPLV Sbjct: 3 SNRSNSCSPGDPLV 16 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 9.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 Q L NSCSPGDPLV Sbjct: 3 QTGLPSNSCSPGDPLV 18 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 93 IFKPQQSLRPNSCSPGDPLV 34 +F ++ NSCSPGDPLV Sbjct: 12 LFVQGNCMKSNSCSPGDPLV 31 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 +R NSCSPGDPLV Sbjct: 53 VRSNSCSPGDPLV 65 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 +S+ NSCSPGDPLV Sbjct: 32 RSITSNSCSPGDPLV 46 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 ++ R NSCSPGDPLV Sbjct: 23 KATRSNSCSPGDPLV 37 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 29.1 bits (62), Expect = 9.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 78 QSLRPNSCSPGDPLV 34 QS NSCSPGDPLV Sbjct: 2 QSSTSNSCSPGDPLV 16 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 36 LVDPPGCRNSAXG 74 LVDPPGCRNS G Sbjct: 15 LVDPPGCRNSIEG 27 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 +R NSCSPGDPLV Sbjct: 321 VRSNSCSPGDPLV 333 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 72 LRPNSCSPGDPLV 34 +R NSCSPGDPLV Sbjct: 4 VRSNSCSPGDPLV 16 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 29.1 bits (62), Expect = 9.0 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 81 QQSLRPNSCSPGDPLV 34 +++L NSCSPGDPLV Sbjct: 93 KRALASNSCSPGDPLV 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,992,937 Number of Sequences: 59808 Number of extensions: 546619 Number of successful extensions: 1920 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 1847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1920 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4542519699 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -