BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D11_e84_07.seq (1507 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 280 2e-75 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 48 2e-05 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.009 SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) 32 1.4 SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.5 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 7.3 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 280 bits (687), Expect = 2e-75 Identities = 124/168 (73%), Positives = 149/168 (88%) Frame = -1 Query: 883 GNIPVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPP 704 G + F+P+NITTEVKSVEMHHE+L EA+PGDNVGFNVKNVSVK+++RG VAGD KNNPP Sbjct: 134 GTVVTFSPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNVAGDFKNNPP 193 Query: 703 RGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSI 524 + FTAQVIV+NHPG+I GY+PVLDCHTAHIACKF ++ EK+DRR+GK EDNPK I Sbjct: 194 KPCKSFTAQVIVMNHPGEIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMI 253 Query: 523 KSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 380 K+GDAA+V ++PSKP+CVE+F EFPPLGRFAVRDM+QTVAVGVIK+V+ Sbjct: 254 KTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVIKSVD 301 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 48.0 bits (109), Expect = 2e-05 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 571 VDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 422 +D++TGK + P+ IK AI L +C+E F +F +GRF +RD Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = -1 Query: 508 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 392 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) Length = 508 Score = 31.9 bits (69), Expect = 1.4 Identities = 25/80 (31%), Positives = 39/80 (48%) Frame = -2 Query: 810 YKKLYPVTMLVSTSKTYLSRNCAVVTLQEIRKTTHPGELQTSQRKSLC*ITQVKYQTDTH 631 ++ L+ VT+ VST T LS T++ R TH Q+S+ S C +Q + Q D Sbjct: 19 FQDLFSVTLEVSTL-TALSAYYEGATVERRRAHTH----QSSENLSCCRRSQEECQVDER 73 Query: 630 LYWIATQPT*PANLPKSKRK 571 L W + P + +K+K Sbjct: 74 LIWSSRCTKKPPSKEAAKKK 93 >SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -1 Query: 634 TPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVE 467 TPVL TAH+ K ++ + D P ++KS ++VN V S L E Sbjct: 223 TPVLRIKTAHVTDKDNRVRSVLIIDNISQAPDTPATLKSSSDSVVNSVGSVGLVAE 278 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/72 (27%), Positives = 30/72 (41%) Frame = -1 Query: 850 TTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVI 671 T + S++ + + G + + + ELRRG V D P R F A V Sbjct: 358 TVRILSLKRNRAPCRVVRAGQSASAALSGIERHELRRGMVMTDPSLEP-RACMCFWADVY 416 Query: 670 VLNHPGQISNGY 635 +L HP IS + Sbjct: 417 LLFHPAAISKRF 428 >SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = -3 Query: 464 LPGIPTPRSFRRA*HEADGRRRCNKGCELQGSRWWQSHQSCRKSHQGQEVASTVNSSVLY 285 L G+P+ F++ H++ RRR + E+ GSR + SH+ Q +V+ + Sbjct: 166 LRGLPSDNVFKKGMHKSLRRRREDVPDEVDGSRGFDVDNEEMVSHENQVFNKSVDLNPGE 225 Query: 284 TTAILHSPKGVQK 246 +LH + +++ Sbjct: 226 FANLLHRNRNIKE 238 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 606 T*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPP 505 T PA P + RK+T Q RTT P PP Sbjct: 1459 TVPATKPPTTRKTTTATTTQGRTTRKPTTTAEPP 1492 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 502 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 413 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -1 Query: 607 HIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKP 479 HIA K E+K D ++ K+ + PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,958,120 Number of Sequences: 59808 Number of extensions: 791834 Number of successful extensions: 2262 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2249 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4882915232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -