BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D07_e52_07.seq (1589 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 27 5.4 SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr... 27 9.5 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 305 CLVSGRSDIARLASLPVWDNHFRCSHLCFFFVN 403 C++SG S++AR+ + FR +CF+ VN Sbjct: 75 CVISGASEVARVRDK---ERVFRIMEVCFYSVN 104 >SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 872 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = -2 Query: 337 PRDI----APPAN*TFGTSISLHRVSFRAWDNDATTTHTHGLNSTSPHSLARLYPSRSHA 170 P+DI + PAN + S S + + D D TH+ N SP S++ S Sbjct: 554 PKDIRSAASTPANPVYNRSSSQTSKGYNSSDYDLLRTHSLDENVNSPTSISSPSSKSSPF 613 Query: 169 SRTT 158 ++TT Sbjct: 614 TKTT 617 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,342,888 Number of Sequences: 5004 Number of extensions: 50698 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 897924822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -