BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D06_e44_08.seq (1503 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38410.1 68415.m04718 VHS domain-containing protein / GAT dom... 29 7.9 At1g15520.1 68414.m01867 ABC transporter family protein similar ... 29 7.9 >At2g38410.1 68415.m04718 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 671 Score = 29.1 bits (62), Expect = 7.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 335 LESKGSPRSARALEPLSDEPKAREAQVESRLVDSAA 442 +++ GSP S +A +P PK+ EA+ S + S++ Sbjct: 323 VQASGSPLSVQASKPADSSPKSSEAKDSSSIAGSSS 358 >At1g15520.1 68414.m01867 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1423 Score = 29.1 bits (62), Expect = 7.9 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +2 Query: 335 LESKGSPRSARALEPLSDEPKAREAQVESRLVDSAADFLENYVIQFKMPSSAVXGIRRSL 514 L S G P++ A EP SDE + + A+ E +V++ A+ V+ F+ S + S+ Sbjct: 776 LNSLGKPQAVIAEEPASDETELQSARSEG-VVEAGANKKRGMVLPFEPHSITFDNVVYSV 834 Query: 515 E 517 + Sbjct: 835 D 835 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,490,066 Number of Sequences: 28952 Number of extensions: 318679 Number of successful extensions: 828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4009654272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -