BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D04_e28_08.seq (1544 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 129 7e-32 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 114 2e-27 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 2e-04 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 25 1.3 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 9.3 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 129 bits (311), Expect = 7e-32 Identities = 57/116 (49%), Positives = 81/116 (69%) Frame = +3 Query: 207 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 386 M + F L WNN+ +++++ F L D VDVTLA +GR L+AH++VLS CSPYF+E+ Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDGRSLKAHRVVLSACSPYFREL 60 Query: 387 FXMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLT 554 P +HP++ L+DV+ S L L++F+Y GEVNV Q L+SF+ TAE L+V GLT Sbjct: 61 LKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSSFLKTAEVLRVSGLT 116 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 114 bits (274), Expect = 2e-27 Identities = 52/112 (46%), Positives = 78/112 (69%), Gaps = 1/112 (0%) Frame = +3 Query: 219 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFXMN 398 + + L WNN+ +NM++ FH LL VDVTLA L+AHK+VLS CS YFQ++ N Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYFQKLLLSN 68 Query: 399 PTQHP-IVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 551 P +HP I+ +DV + L+ +++F+Y+GE++V Q EL S + TA+QL++KGL Sbjct: 69 PCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQSLLKTADQLKIKGL 120 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 2e-04 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +3 Query: 207 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 323 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 456 LLQFMYQGEVNVKQEELASFIS-TAEQLQVKGLTGNQNEE 572 ++ +Y G VNV+ E + S++ ++ V GN NE+ Sbjct: 43 IIDEVYNGNVNVEDENVQSYVECMMKKFNVVDENGNFNEK 82 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 9.3 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 574 LSSF*FPVKPFT*SCSAVLINDANSSCLTLTSP 476 LSS P T + S ++ N NS+C SP Sbjct: 323 LSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSP 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 334,390 Number of Sequences: 438 Number of extensions: 7140 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54190125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -