BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_D02_e12_08.seq (1515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 3e-24 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 2e-20 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-20 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-20 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 7e-20 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 1e-19 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 2e-19 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 5e-19 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 1e-18 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-18 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 3e-18 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 4e-18 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 89 1e-17 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 88 2e-17 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 8e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 84 3e-16 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 83 7e-16 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 74 3e-13 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 8e-13 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 72 1e-12 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 70 4e-12 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 69 1e-11 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 67 3e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 67 3e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 67 3e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 67 3e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 67 3e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 67 3e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 67 3e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 66 5e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 66 5e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 66 5e-11 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 66 5e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 66 5e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 66 5e-11 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 64 3e-10 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 64 4e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 64 4e-10 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 64 4e-10 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 63 6e-10 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 63 6e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 63 6e-10 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 63 6e-10 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 63 6e-10 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 63 6e-10 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 63 6e-10 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 63 6e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 63 6e-10 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 63 6e-10 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 63 6e-10 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 63 6e-10 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 63 6e-10 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 63 6e-10 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 63 6e-10 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 63 6e-10 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 63 6e-10 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 63 6e-10 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 63 6e-10 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 63 6e-10 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 63 6e-10 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 63 6e-10 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 63 6e-10 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 63 6e-10 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 63 6e-10 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 63 6e-10 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 63 6e-10 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 63 6e-10 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 63 6e-10 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 63 6e-10 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 63 6e-10 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 63 6e-10 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 63 6e-10 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 63 6e-10 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 63 6e-10 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 63 6e-10 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 63 6e-10 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 63 6e-10 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 63 6e-10 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 63 6e-10 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 63 6e-10 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 63 6e-10 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 63 6e-10 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 63 6e-10 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 63 6e-10 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 63 6e-10 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 63 6e-10 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 63 6e-10 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 63 6e-10 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 63 6e-10 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 63 6e-10 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 63 6e-10 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 63 6e-10 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 63 6e-10 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 63 6e-10 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 63 6e-10 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 63 6e-10 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 63 6e-10 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 63 6e-10 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 63 6e-10 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 63 6e-10 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 63 6e-10 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 63 6e-10 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 63 6e-10 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 63 6e-10 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 63 6e-10 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 63 6e-10 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 63 6e-10 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 63 6e-10 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 63 6e-10 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 63 6e-10 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 63 6e-10 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 63 6e-10 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 63 6e-10 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 63 6e-10 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 63 6e-10 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 63 6e-10 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 63 6e-10 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 63 6e-10 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 63 6e-10 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 63 6e-10 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 63 6e-10 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 63 6e-10 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 63 6e-10 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 63 6e-10 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 63 6e-10 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 63 6e-10 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 63 6e-10 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 63 6e-10 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 63 6e-10 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 63 6e-10 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 63 6e-10 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 63 6e-10 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 63 6e-10 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 63 6e-10 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 63 6e-10 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 63 6e-10 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 63 6e-10 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 63 6e-10 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 63 6e-10 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 63 6e-10 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 63 6e-10 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 63 6e-10 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 63 6e-10 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 63 6e-10 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 63 6e-10 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 63 6e-10 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 110 bits (264), Expect = 3e-24 Identities = 52/58 (89%), Positives = 53/58 (91%), Gaps = 1/58 (1%) Frame = -1 Query: 702 QXLGRAIGAGLFAITPAGGKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 Q LGRAIGAGLFAITPAG KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 45 QLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 103 bits (248), Expect = 3e-22 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTLALPNLIALQHIP ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQL 52 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 101 bits (242), Expect = 2e-21 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -3 Query: 691 KGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 +GDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 97.9 bits (233), Expect = 2e-20 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 535 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLS + +EEARTDRPSQ L Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQL 88 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.5 bits (232), Expect = 2e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLS + NSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQL 52 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 96.7 bits (230), Expect = 4e-20 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 541 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLS + + EEARTDRPSQ L Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQL 130 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 96.7 bits (230), Expect = 4e-20 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTLALPNLIALQ P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRL 52 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.9 bits (228), Expect = 7e-20 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -3 Query: 706 AAXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 A +GKGDRCGPLRYYASWRKG RRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.1 bits (226), Expect = 1e-19 Identities = 42/48 (87%), Positives = 42/48 (87%) Frame = -3 Query: 703 AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 A VGKGDRCGPLRYYASWRKG RLSWVTPGFSQSRRCKTTASEL Sbjct: 3 ATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 94.7 bits (225), Expect = 2e-19 Identities = 45/51 (88%), Positives = 45/51 (88%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTLALPNLIAL P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQL 52 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 93.1 bits (221), Expect = 5e-19 Identities = 42/51 (82%), Positives = 42/51 (82%) Frame = -3 Query: 712 QXAAXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 Q A VGKGDRCGPLRYYASWRKG A RLS TPGFSQSRRCKTTASEL Sbjct: 29 QGCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 91.9 bits (218), Expect = 1e-18 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +1 Query: 565 HWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 HWPSFYNVVTGKTLALPNLIALQHIPLS + RNSEEARTDRPSQ L Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQL 50 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 91.1 bits (216), Expect = 2e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTLALPNL L+HIPL AS SEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQL 52 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 90.6 bits (215), Expect = 3e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 565 HWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQ 696 HWPSFYN VTGKTLALPNLIALQHIP ASWRNS+EARTDRPSQ Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRPSQ 48 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 90.2 bits (214), Expect = 4e-18 Identities = 42/57 (73%), Positives = 45/57 (78%) Frame = -1 Query: 702 QXLGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 Q LGRAIGAGLFAITPAG +G + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 11 QLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 88.6 bits (210), Expect = 1e-17 Identities = 45/64 (70%), Positives = 47/64 (73%) Frame = +1 Query: 511 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRP 690 T GGA PIRPIVSRITIHWP+FYN TGKTLA L L P ASWRNS+EAR DRP Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 Query: 691 SQXL 702 SQ L Sbjct: 92 SQQL 95 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 87.8 bits (208), Expect = 2e-17 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = -1 Query: 702 QXLGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 Q LGRAIGAGLFAITPAG +G + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 5 QLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 85.8 bits (203), Expect = 8e-17 Identities = 41/52 (78%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGK P+L LQ+IPL ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQL 53 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 83.8 bits (198), Expect = 3e-16 Identities = 39/61 (63%), Positives = 46/61 (75%) Frame = -1 Query: 717 QFXXRQXLGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRA 538 ++ Q LGR+IGAGLFAITPAG +G + +G +GFPSHD KRRPVNCNTTHYRA Sbjct: 37 RYRVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 Query: 537 N 535 N Sbjct: 97 N 97 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 83.4 bits (197), Expect = 4e-16 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = -1 Query: 702 QXLGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 Q LGRAIGAGLFAITPAG +G + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1844 QLLGRAIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 82.6 bits (195), Expect = 7e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -1 Query: 687 AIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 AIGAGLFAITPAG +G + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.8 bits (193), Expect = 1e-15 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGKTL++ L L P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 81.0 bits (191), Expect = 2e-15 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = -1 Query: 696 LGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 +G+ GLFAITPAG +G + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 5 VGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.4 bits (182), Expect = 3e-14 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGK + L L P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.4 bits (182), Expect = 3e-14 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGK + L L P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 76.6 bits (180), Expect = 5e-14 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVVTGK + L L P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 73.7 bits (173), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLS 648 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLS 34 Score = 37.1 bits (82), Expect = 0.037 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +2 Query: 653 AGVIAKRPAPIALPNXCRXLN 715 AGVIAKRPAPIALP R LN Sbjct: 36 AGVIAKRPAPIALPKQLRSLN 56 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 8e-13 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = +1 Query: 565 HWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 HWPSFYNVVTGKTL + L L P ASWRNSEEARTDRPSQ L Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 50 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 71.7 bits (168), Expect = 1e-12 Identities = 39/59 (66%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +3 Query: 579 LQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*IGEWEI-CKRYXLL 752 LQRRDWENPGVTQLNRLAAHPPF R PHRSPFPT A EW + RY LL Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQ---PEWRMGLMRYFLL 402 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.9 bits (166), Expect = 2e-12 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNV+ KT + L L P ASWRNSE+ARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQL 52 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 70.1 bits (164), Expect = 4e-12 Identities = 42/64 (65%), Positives = 42/64 (65%) Frame = +1 Query: 511 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRP 690 T GGA PIRPIVS ITIHWPSFYN VT H P ASWRNSEEARTDRP Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVTA------------HPPF-ASWRNSEEARTDRP 80 Query: 691 SQXL 702 SQ L Sbjct: 81 SQQL 84 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 68.9 bits (161), Expect = 1e-11 Identities = 35/56 (62%), Positives = 37/56 (66%) Frame = -3 Query: 727 SHSPIQXAAXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+G KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 44 SHSPFRLR-NCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 68.9 bits (161), Expect = 1e-11 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = +1 Query: 550 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 SRITIHWPSFYNVV + + L L P ASWRNSEEARTDRPSQ L Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.5 bits (160), Expect = 1e-11 Identities = 35/56 (62%), Positives = 38/56 (67%) Frame = +1 Query: 535 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSASWRNSEEARTDRPSQXL 702 IRPIVSRITIHWPSFY + + L L P ASWR+SEEARTDRPSQ L Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQL 73 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 215 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 370 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 286 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 26 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 260 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 444 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 279 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 129 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 580 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 494 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 67.3 bits (157), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 560 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 178 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 892 CWEGRSVRASSLLRQLAKGGCAARRL 917 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 38.3 bits (85), Expect = 0.016 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 695 WEGRSVRASSLLRQLAERGMCCKAI 621 WEGRSVRASSLLRQLA+ G + + Sbjct: 5 WEGRSVRASSLLRQLAKGGCAARRL 29 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 228 CWEGRSVRASSLLRQLAKGGCAARRL 253 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 361 CWEGRSVRASSLLRQLAKGGCAARRL 386 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.5 bits (155), Expect = 5e-11 Identities = 37/62 (59%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL*YD 551 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTASE D Sbjct: 3 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTASEFPGD 60 Query: 550 SL 545 L Sbjct: 61 PL 62 Score = 62.5 bits (145), Expect = 9e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPF 647 LAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPF 111 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 640 PLSASWRNSEEARTDRPSQXL 702 P ASWRNSEEARTDRPSQ L Sbjct: 109 PPFASWRNSEEARTDRPSQQL 129 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 271 CWEGRSVRASSLLRQLAKGGCAARRL 296 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 255 CWEGRSVRASSLLRQLAKGGCAARRL 280 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 244 CWEGRSVRASSLLRQLAKGGCAARRL 269 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 122 CWEGRSVRASSLLRQLAKGGCAARRL 147 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 695 WEGRSVRASSLLRQLAERGMCCKAI 621 W+GRSVR SLLRQL + G + + Sbjct: 332 WKGRSVRTYSLLRQLVKGGCAARRL 356 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 686 RSVRASSLLRQLAERGMCCKAI 621 RSVRASSLLRQLA+ G + + Sbjct: 2 RSVRASSLLRQLAKGGCAARRL 23 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 45.6 bits (103), Expect = 1e-04 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -2 Query: 728 FPFANSX-CGXCWEGRSVRASSLLRQLAERGMCCKAI 621 FP ANS CWEGRSVRASSLLRQLA+ G + + Sbjct: 186 FPSANSNKLRNCWEGRSVRASSLLRQLAKGGCAARRL 222 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 225 CWEGRSVRASSLLRQLAKGGCAARRL 250 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -2 Query: 725 PFANSXCGXCWEGRSVRASSLLRQLAERGMCCKAI 621 P A S CWEGRSVRASSLLRQLA+ G + + Sbjct: 77 PEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRL 111 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 394 CWEGRSVRASSLLRQLAKGGCAARRL 419 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 686 RSVRASSLLRQLAERGMCCKAI 621 RSVRASSLLRQLA+ G + + Sbjct: 2 RSVRASSLLRQLAKGGCAARRL 23 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 64.9 bits (151), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASE 563 KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 551 KGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 534 CWEGRSVRASSLLRQLAKGGCAARRL 559 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 64.9 bits (151), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 565 HWPSFYNVVTGKTLALPNLIALQHIPLS 648 HWPSFYNVVTGKTLALPNLIALQHIPLS Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLS 89 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 653 AGVIAKRPAPIALPNXC 703 AGVIAKRPAPIALPN C Sbjct: 91 AGVIAKRPAPIALPNSC 107 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 64.9 bits (151), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 565 HWPSFYNVVTGKTLALPNLIALQHIPLS 648 HWPSFYNVVTGKTLALPNLIALQHIPLS Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLS 84 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 653 AGVIAKRPAPIALPNXC 703 AGVIAKRPAPIALPN C Sbjct: 86 AGVIAKRPAPIALPNSC 102 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 64.5 bits (150), Expect = 2e-10 Identities = 38/73 (52%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 127 Query: 744 XLLKIRVKFXXKS 782 LL ++ KS Sbjct: 128 FLLTHLCEYEGKS 140 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 64.1 bits (149), Expect = 3e-10 Identities = 40/81 (49%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +3 Query: 513 SRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPF 692 SRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPF R+ Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDR 872 Query: 693 PTXAAX*I-GEWEICKRYXLL 752 P+ + GEW + RY LL Sbjct: 873 PSQQLRSLNGEWRL-MRYFLL 892 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 64.1 bits (149), Expect = 3e-10 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = -1 Query: 702 QXLGRAIGAGLFAITPAGGKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 532 Q + R A + A TP+G K + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 3 QLIPRETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 63.7 bits (148), Expect = 4e-10 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + +R Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRLMRRQ 157 Query: 744 XLLKIRV 764 K R+ Sbjct: 158 VRAKQRL 164 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 4e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 609 RQGFPSHDVVKRRPVNCNTTHYRANW 532 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 63.7 bits (148), Expect = 4e-10 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -3 Query: 727 SHSPIQXA-AXVGKGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 566 SHSP + G+ R L + KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 31 SHSPFRLRNCWEGRSVRASSLLRQLA--KGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 63.7 bits (148), Expect = 4e-10 Identities = 35/84 (41%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + + + Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRLMRYF 421 Query: 744 XLLKIRVKFXXKSAXFYHXPXIGK 815 L + + + A +G+ Sbjct: 422 LLTHLCADWRYRHAGLMAISAVGE 445 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 3/38 (7%) Frame = -3 Query: 670 LRYYASWR---KGGCAARRLSWVTPGFSQSRRCKTTAS 566 +R Y+ +R KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 11 VRAYSLFRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRA SL RQLA+ G + + Sbjct: 5 CWEGRSVRAYSLFRQLAKGGCAARRL 30 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 497 KGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 480 CWEGRSVRASSLLRQLAKGGCAARRL 505 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 118 Query: 744 XLL 752 LL Sbjct: 119 FLL 121 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 167 KGGCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 150 CWEGRSVRASSLLRQLAKGGCAARRL 175 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 81 Query: 744 XLL 752 LL Sbjct: 82 FLL 84 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 105 Query: 744 XLL 752 LL Sbjct: 106 FLL 108 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 84 Query: 744 XLL 752 LL Sbjct: 85 FLL 87 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 244 KGGCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 227 CWEGRSVRASSLLRQLAKGGCAARRL 252 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 170 Query: 744 XLL 752 LL Sbjct: 171 FLL 173 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 388 KGGCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 371 CWEGRSVRASSLLRQLAKGGCAARRL 396 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 95 Query: 744 XLL 752 LL Sbjct: 96 FLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 67 Query: 744 XLL 752 LL Sbjct: 68 FLL 70 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 144 Query: 744 XLL 752 LL Sbjct: 145 FLL 147 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 90 KGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 73 CWEGRSVRASSLLRQLAKGGCAARRL 98 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 78 Query: 744 XLL 752 LL Sbjct: 79 FLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 209 Query: 744 XLL 752 LL Sbjct: 210 FLL 212 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 113 Query: 744 XLL 752 LL Sbjct: 114 FLL 116 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 671 KGGCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 654 CWEGRSVRASSLLRQLAKGGCAARRL 679 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 116 Query: 744 XLL 752 LL Sbjct: 117 FLL 119 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 269 Query: 744 XLL 752 LL Sbjct: 270 FLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 104 Query: 744 XLL 752 LL Sbjct: 105 FLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 96 Query: 744 XLL 752 LL Sbjct: 97 FLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 131 Query: 744 XLL 752 LL Sbjct: 132 FLL 134 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 177 KGGCAARRLSWVTPGFSQSRRCKTTAS 203 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 78 Query: 744 XLL 752 LL Sbjct: 79 FLL 81 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 113 Query: 744 XLL 752 LL Sbjct: 114 FLL 116 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 129 Query: 744 XLL 752 LL Sbjct: 130 FLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 84 Query: 744 XLL 752 LL Sbjct: 85 FLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 115 Query: 744 XLL 752 LL Sbjct: 116 FLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 144 Query: 744 XLL 752 LL Sbjct: 145 FLL 147 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 156 Query: 744 XLL 752 LL Sbjct: 157 FLL 159 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 88 Query: 744 XLL 752 LL Sbjct: 89 FLL 91 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 181 Query: 744 XLL 752 LL Sbjct: 182 FLL 184 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 152 Query: 744 XLL 752 LL Sbjct: 153 FLL 155 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 117 Query: 744 XLL 752 LL Sbjct: 118 FLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 140 Query: 744 XLL 752 LL Sbjct: 141 FLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 140 Query: 744 XLL 752 LL Sbjct: 141 FLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 140 Query: 744 XLL 752 LL Sbjct: 141 FLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 121 Query: 744 XLL 752 LL Sbjct: 122 FLL 124 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 80 Query: 744 XLL 752 LL Sbjct: 81 FLL 83 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 164 Query: 744 XLL 752 LL Sbjct: 165 FLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 80 Query: 744 XLL 752 LL Sbjct: 81 FLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 99 Query: 744 XLL 752 LL Sbjct: 100 FLL 102 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 62.9 bits (146), Expect = 6e-10 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTASEL 560 KGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPVFSQSRRCKTTASEL 49 Score = 38.3 bits (85), Expect = 0.016 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 695 WEGRSVRASSLLRQLAERGMCCKAI 621 WEGRSVRASSLLRQLA+ G + + Sbjct: 5 WEGRSVRASSLLRQLAKGGCAARRL 29 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 132 Query: 744 XLL 752 LL Sbjct: 133 FLL 135 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 580 KGGCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 563 CWEGRSVRASSLLRQLAKGGCAARRL 588 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 123 Query: 744 XLL 752 LL Sbjct: 124 FLL 126 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 147 Query: 744 XLL 752 LL Sbjct: 148 FLL 150 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 427 KGGCAARRLSWVTPGFSQSRRCKTTAS 453 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 410 CWEGRSVRASSLLRQLAKGGCAARRL 435 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 97 Query: 744 XLL 752 LL Sbjct: 98 FLL 100 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 190 Query: 744 XLL 752 LL Sbjct: 191 FLL 193 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 54 KGGCAARRLSWVTPGFSQSRRCKTTAS 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 37 CWEGRSVRASSLLRQLAKGGCAARRL 62 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 238 Query: 744 XLL 752 LL Sbjct: 239 FLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 115 Query: 744 XLL 752 LL Sbjct: 116 FLL 118 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 202 Query: 744 XLL 752 LL Sbjct: 203 FLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 114 Query: 744 XLL 752 LL Sbjct: 115 FLL 117 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 810 KGGCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 793 CWEGRSVRASSLLRQLAKGGCAARRL 818 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 172 Query: 744 XLL 752 LL Sbjct: 173 FLL 175 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 471 KGGCAARRLSWVTPGFSQSRRCKTTAS 497 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 454 CWEGRSVRASSLLRQLAKGGCAARRL 479 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 79 Query: 744 XLL 752 LL Sbjct: 80 FLL 82 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 708 Query: 744 XLL 752 LL Sbjct: 709 FLL 711 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 95 Query: 744 XLL 752 LL Sbjct: 96 FLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 217 Query: 744 XLL 752 LL Sbjct: 218 FLL 220 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 90 KGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 38.3 bits (85), Expect = 0.016 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 695 WEGRSVRASSLLRQLAERGMCCKAI 621 WEGRSVRASSLLRQLA+ G + + Sbjct: 74 WEGRSVRASSLLRQLAKGGCAARRL 98 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 78 Query: 744 XLL 752 LL Sbjct: 79 FLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 126 Query: 744 XLL 752 LL Sbjct: 127 FLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 127 Query: 744 XLL 752 LL Sbjct: 128 FLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 135 Query: 744 XLL 752 LL Sbjct: 136 FLL 138 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 241 Query: 744 XLL 752 LL Sbjct: 242 FLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 500 Query: 744 XLL 752 LL Sbjct: 501 FLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 129 Query: 744 XLL 752 LL Sbjct: 130 FLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 322 Query: 744 XLL 752 LL Sbjct: 323 FLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 90 Query: 744 XLL 752 LL Sbjct: 91 FLL 93 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 36 KGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = -2 Query: 725 PFANSXCGXCWEGRSVRASSLLRQLAERGMCCKAI 621 PFA WEGRSVRASSLLRQLA+ G + + Sbjct: 11 PFAIQAA-QLWEGRSVRASSLLRQLAKGGCAARRL 44 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 126 Query: 744 XLL 752 LL Sbjct: 127 FLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 160 Query: 744 XLL 752 LL Sbjct: 161 FLL 163 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 119 Query: 744 XLL 752 LL Sbjct: 120 FLL 122 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 129 Query: 744 XLL 752 LL Sbjct: 130 FLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 129 Query: 744 XLL 752 LL Sbjct: 130 FLL 132 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 392 KGGCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 375 CWEGRSVRASSLLRQLAKGGCAARRL 400 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 130 Query: 744 XLL 752 LL Sbjct: 131 FLL 133 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1126 KGGCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 1109 CWEGRSVRASSLLRQLAKGGCAARRL 1134 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 317 KGGCAARRLSWVTPGFSQSRRCKTTAS 343 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 300 CWEGRSVRASSLLRQLAKGGCAARRL 325 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 139 Query: 744 XLL 752 LL Sbjct: 140 FLL 142 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 131 KGGCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 114 CWEGRSVRASSLLRQLAKGGCAARRL 139 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 41 KGGCAARRLSWVTPGFSQSRRCKTTAS 67 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 24 CWEGRSVRASSLLRQLAKGGCAARRL 49 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 232 Query: 744 XLL 752 LL Sbjct: 233 FLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 87 Query: 744 XLL 752 LL Sbjct: 88 FLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 139 Query: 744 XLL 752 LL Sbjct: 140 FLL 142 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 KGGCAARRLSWVTPGFSQSRRCKTTAS 29 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 105 Query: 744 XLL 752 LL Sbjct: 106 FLL 108 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTAS 41 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 686 RSVRASSLLRQLAERGMCCKAI 621 RSVRASSLLRQLA+ G + + Sbjct: 2 RSVRASSLLRQLAKGGCAARRL 23 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 124 Query: 744 XLL 752 LL Sbjct: 125 FLL 127 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 113 Query: 744 XLL 752 LL Sbjct: 114 FLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 125 Query: 744 XLL 752 LL Sbjct: 126 FLL 128 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 94 Query: 744 XLL 752 LL Sbjct: 95 FLL 97 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 100 Query: 744 XLL 752 LL Sbjct: 101 FLL 103 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 118 Query: 744 XLL 752 LL Sbjct: 119 FLL 121 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 137 Query: 744 XLL 752 LL Sbjct: 138 FLL 140 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 36 KGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 692 EGRSVRASSLLRQLAERGMCCKAI 621 EGRSVRASSLLRQLA+ G + + Sbjct: 21 EGRSVRASSLLRQLAKGGCAARRL 44 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 143 Query: 744 XLL 752 LL Sbjct: 144 FLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 160 Query: 744 XLL 752 LL Sbjct: 161 FLL 163 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 44 KGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 27 CWEGRSVRASSLLRQLAKGGCAARRL 52 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 94 Query: 744 XLL 752 LL Sbjct: 95 FLL 97 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 646 KGGCAARRLSWVTPGFSQSRRCKTTAS 566 KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 698 CWEGRSVRASSLLRQLAERGMCCKAI 621 CWEGRSVRASSLLRQLA+ G + + Sbjct: 5 CWEGRSVRASSLLRQLAKGGCAARRL 30 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 106 Query: 744 XLL 752 LL Sbjct: 107 FLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +3 Query: 567 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA**RRGPHRSPFPTXAAX*I-GEWEICKRY 743 LAVVLQRRDWENPGVTQLNRLAAHPPF R+ P+ + GEW + RY Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR--NSEEARTDRPSQQLRSLNGEWRL-MRY 105 Query: 744 XLL 752 LL Sbjct: 106 FLL 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,599,556 Number of Sequences: 59808 Number of extensions: 521198 Number of successful extensions: 7826 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7614 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -