BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_C04_e27_06.seq (1503 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000DD8621 Cluster: PREDICTED: hypothetical protein;... 36 3.6 UniRef50_UPI0000357952 Cluster: PREDICTED: similar to RNP partic... 34 8.4 >UniRef50_UPI0000DD8621 Cluster: PREDICTED: hypothetical protein; n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein - Homo sapiens Length = 560 Score = 35.5 bits (78), Expect = 3.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +3 Query: 126 DGSGSSDGWARRVSSVMSARVLATWSGRRLLATRSCLDSFDEPRPW 263 +GSG+ GW+R S V + W R + TRS + D RPW Sbjct: 439 EGSGAKGGWSREASGVPAPGGGWPWVSREVPGTRSFGPAPDSTRPW 484 >UniRef50_UPI0000357952 Cluster: PREDICTED: similar to RNP particle component; n=1; Mus musculus|Rep: PREDICTED: similar to RNP particle component - Mus musculus Length = 183 Score = 34.3 bits (75), Expect = 8.4 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 129 GSGSSDGWARRVSSVMSARVLATWSGRRLLATRSCLDSFDEPRPWKQR 272 G G G S +S+R L T+ RR +A R C D +D W R Sbjct: 27 GQGPFSGLIFNQESELSSRPLCTFPARRKVACRECSDHWDSGESWTPR 74 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 863,770,465 Number of Sequences: 1657284 Number of extensions: 13536638 Number of successful extensions: 31547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31381 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 159698672100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -