BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_C03_e19_05.seq (1600 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0756 - 21272122-21272784 30 5.9 08_02_0462 + 17444726-17445135,17445271-17445546,17446523-17448461 29 7.8 >07_03_0756 - 21272122-21272784 Length = 220 Score = 29.9 bits (64), Expect = 5.9 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 13 PAVAAALXTSGIPRAAGNSARGXPRLHGRLKR 108 PA AA + R G ARG PRL GRL+R Sbjct: 20 PAAAARAAAARRVRGGGGEARG-PRLRGRLRR 50 >08_02_0462 + 17444726-17445135,17445271-17445546,17446523-17448461 Length = 874 Score = 29.5 bits (63), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 336 DGVSCDRSATMGCSPSRWESGL*VKSFRDWRTRTN-QGYSLVRDLYVI 196 +GV+C+ + +GC PS + L V +RD + G+S +RD I Sbjct: 735 EGVNCEDLSIIGCLPSLLQLSLRVPGYRDSLIISGCYGFSCLRDFCFI 782 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,915,441 Number of Sequences: 37544 Number of extensions: 543776 Number of successful extensions: 1168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5186142276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -