BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_C02_e11_06.seq (1512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47519| Best HMM Match : rve (HMM E-Value=4.3e-09) 71 3e-12 SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_26065| Best HMM Match : Peptidase_A17 (HMM E-Value=6.5e-19) 69 7e-12 SB_56538| Best HMM Match : rve (HMM E-Value=3.6e-09) 67 3e-11 SB_1216| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_57856| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_13011| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) 63 6e-10 SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41854| Best HMM Match : FA_hydroxylase (HMM E-Value=2.8) 58 2e-08 SB_33851| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_57513| Best HMM Match : rve (HMM E-Value=0.0064) 58 2e-08 SB_27339| Best HMM Match : rve (HMM E-Value=0.0016) 56 1e-07 SB_3976| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) 55 2e-07 SB_11376| Best HMM Match : Agenet (HMM E-Value=0.69) 54 3e-07 SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) 53 5e-07 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_25562| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) 53 7e-07 SB_53674| Best HMM Match : rve (HMM E-Value=0.00095) 53 7e-07 SB_45491| Best HMM Match : Agenet (HMM E-Value=1.4) 52 9e-07 SB_59447| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51460| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-33) 52 9e-07 SB_51210| Best HMM Match : rve (HMM E-Value=2.2e-13) 52 9e-07 SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018) 52 9e-07 SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) 52 9e-07 SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_31806| Best HMM Match : rve (HMM E-Value=1.9e-07) 52 1e-06 SB_52674| Best HMM Match : Peptidase_A17 (HMM E-Value=3.9e-07) 50 4e-06 SB_31396| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_47175| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 8e-06 SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 8e-06 SB_932| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-11) 49 1e-05 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 48 2e-05 SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) 47 3e-05 SB_37714| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_7499| Best HMM Match : zf-CCHC (HMM E-Value=0.00029) 46 6e-05 SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) 46 8e-05 SB_19063| Best HMM Match : rve (HMM E-Value=3.6e-14) 45 2e-04 SB_13495| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_22757| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 42 0.001 SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 42 0.001 SB_54444| Best HMM Match : zf-CCHC (HMM E-Value=0.035) 41 0.003 SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) 41 0.003 SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27479| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_23072| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 38 0.016 SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 38 0.016 SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) 38 0.021 SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.021 SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) 38 0.028 SB_19007| Best HMM Match : rve (HMM E-Value=2e-12) 37 0.037 SB_52583| Best HMM Match : rve (HMM E-Value=0.00025) 37 0.037 SB_15661| Best HMM Match : rve (HMM E-Value=3e-10) 37 0.037 SB_8488| Best HMM Match : Kelch_1 (HMM E-Value=3.3e-13) 37 0.037 SB_4534| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.037 SB_26839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.048 SB_24920| Best HMM Match : HSP20 (HMM E-Value=5) 37 0.048 SB_37923| Best HMM Match : rve (HMM E-Value=1.2e-12) 36 0.064 SB_25688| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_15755| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_11984| Best HMM Match : rve (HMM E-Value=2.3) 36 0.064 SB_3018| Best HMM Match : Cathelicidins (HMM E-Value=5.9) 36 0.085 SB_40650| Best HMM Match : PAM2 (HMM E-Value=6.6) 36 0.11 SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) 36 0.11 SB_3390| Best HMM Match : PAM2 (HMM E-Value=1.6) 36 0.11 SB_31254| Best HMM Match : rve (HMM E-Value=5.2e-15) 35 0.15 SB_21620| Best HMM Match : C1_1 (HMM E-Value=4.7) 35 0.15 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 35 0.15 SB_15838| Best HMM Match : Peptidase_A17 (HMM E-Value=7.9e-32) 35 0.15 SB_13977| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.15 SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.15 SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) 35 0.15 SB_1129| Best HMM Match : PAM2 (HMM E-Value=0.028) 35 0.15 SB_57991| Best HMM Match : rve (HMM E-Value=1.1e-10) 34 0.34 SB_45156| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_52435| Best HMM Match : RYDR_ITPR (HMM E-Value=1.4) 33 0.79 SB_29621| Best HMM Match : Halo_GVPC (HMM E-Value=5.3) 31 1.8 SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) 31 2.4 SB_45299| Best HMM Match : AIG2 (HMM E-Value=1.7) 31 2.4 SB_21352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_7238| Best HMM Match : rve (HMM E-Value=0.0017) 31 2.4 SB_54682| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_57360| Best HMM Match : Peptidase_A17 (HMM E-Value=8.9e-29) 30 4.2 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 30 4.2 SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_8626| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_51890| Best HMM Match : BCCT (HMM E-Value=0) 30 5.6 SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) 29 7.4 SB_19470| Best HMM Match : rve (HMM E-Value=0.0029) 29 7.4 SB_22271| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_14900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 >SB_47519| Best HMM Match : rve (HMM E-Value=4.3e-09) Length = 321 Score = 70.5 bits (165), Expect = 3e-12 Identities = 37/90 (41%), Positives = 48/90 (53%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW + EY+ L QRSKWR R L DLVLI E + WRLGRV L Sbjct: 230 LADQFWRQWRREYVPHLVQRSKWRAIQRNLRRGDLVLIVERDVPRGKWRLGRVLTLIASP 289 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE++T G + R + +L LL S+ Sbjct: 290 DGLVRSAEVATTKGTLIRPVGKLALLEASQ 319 >SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 69.3 bits (162), Expect = 7e-12 Identities = 37/90 (41%), Positives = 47/90 (52%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R EY+ L QRSKWR R L DLVLI E + WRLGRV Sbjct: 898 LADQFWRRWRREYVPHLVQRSKWRAIQRNLRRGDLVLIVERDVPRGKWRLGRVLAPIASP 957 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE++T G + R + +L LL S+ Sbjct: 958 DGLVRSAEVATTKGTLIRPVGKLALLEASQ 987 >SB_26065| Best HMM Match : Peptidase_A17 (HMM E-Value=6.5e-19) Length = 317 Score = 69.3 bits (162), Expect = 7e-12 Identities = 37/90 (41%), Positives = 47/90 (52%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R EY+ L QRSKWR R L DLVLI E + WRLGRV Sbjct: 226 LADQFWRRWRREYVPHLVQRSKWRAIQRNLRRGDLVLIVERDVPRGKWRLGRVLAPIASP 285 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE++T G + R + +L LL S+ Sbjct: 286 DGLVRSAEVATTKGTLIRPVGKLALLEASQ 315 >SB_56538| Best HMM Match : rve (HMM E-Value=3.6e-09) Length = 317 Score = 67.3 bits (157), Expect = 3e-11 Identities = 33/90 (36%), Positives = 47/90 (52%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 225 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWPLARVINVFPGV 284 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE+ +R + +L LL + Sbjct: 285 DGLVRSAEVRGKGTTYKRPVTKLCLLEAED 314 >SB_1216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1834 Score = 66.9 bits (156), Expect = 4e-11 Identities = 33/90 (36%), Positives = 47/90 (52%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 1742 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWPLARVIDVFPGV 1801 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE+ +R + +L LL + Sbjct: 1802 DGLVRSAEVRGKGTTYKRPVTKLCLLEAED 1831 >SB_57856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 66.5 bits (155), Expect = 5e-11 Identities = 36/90 (40%), Positives = 46/90 (51%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R EY+ L QRSKWR R L DLVLI E + WRLG V Sbjct: 148 LADQFWRRWRREYVPHLVQRSKWRAIQRNLRRGDLVLIVERDVPRGKWRLGLVLTPIASP 207 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE++T G + R + +L LL S+ Sbjct: 208 DGLVRSAEVATTKGTLIRPVGKLALLEASQ 237 >SB_13011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 571 Score = 66.5 bits (155), Expect = 5e-11 Identities = 36/90 (40%), Positives = 46/90 (51%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R EY+ L QRSKWR R L DLVLI E + WRLG V Sbjct: 480 LADQFWRRWRREYVPHLVQRSKWRAIQRNLRRGDLVLIVERDVPRGKWRLGLVLTPIASP 539 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 D + R AE++T G + R + +L LL S+ Sbjct: 540 DGLVRSAEVATTKGTLIRPVGKLALLEASQ 569 >SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) Length = 1740 Score = 62.9 bits (146), Expect = 6e-10 Identities = 29/69 (42%), Positives = 39/69 (56%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 1647 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWALARVINVFPGV 1706 Query: 413 DNIPRVAEL 439 D + R AE+ Sbjct: 1707 DGLVRSAEV 1715 >SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 60.5 bits (140), Expect = 3e-09 Identities = 27/69 (39%), Positives = 39/69 (56%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 1257 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWPLARVINVFPGV 1316 Query: 413 DNIPRVAEL 439 D + + A++ Sbjct: 1317 DGLTKKAKI 1325 >SB_41854| Best HMM Match : FA_hydroxylase (HMM E-Value=2.8) Length = 476 Score = 58.0 bits (134), Expect = 2e-08 Identities = 26/63 (41%), Positives = 35/63 (55%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 25 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWPLARVINVFPGV 84 Query: 413 DNI 421 D + Sbjct: 85 DGL 87 >SB_33851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.0 bits (134), Expect = 2e-08 Identities = 26/63 (41%), Positives = 35/63 (55%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + H+W R EYI LQ RSKW K R L++ D+VL+ + N W L RV +F G Sbjct: 59 LANHYWRRWLKEYIPSLQVRSKWNRKQRNLHVGDIVLVADDNVGRNNWPLARVINVFPGV 118 Query: 413 DNI 421 D + Sbjct: 119 DGL 121 >SB_57513| Best HMM Match : rve (HMM E-Value=0.0064) Length = 515 Score = 57.6 bits (133), Expect = 2e-08 Identities = 29/82 (35%), Positives = 41/82 (50%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIP 424 +W R EYI LQ+R KW + R L+ DLVL+ + N W L V F G D Sbjct: 427 YWRRWLKEYIPSLQERRKWHLPTRNLHAGDLVLVADDNVRRNKWPLSLVMNTFPGRDGRV 486 Query: 425 RVAELSTVNGIVRRALNRLVLL 490 R E+ ++RR + ++ LL Sbjct: 487 RNVEVRVDGRVLRRPVTKICLL 508 >SB_27339| Best HMM Match : rve (HMM E-Value=0.0016) Length = 551 Score = 55.6 bits (128), Expect = 1e-07 Identities = 27/82 (32%), Positives = 44/82 (53%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIP 424 FW R EY+ LQ RSKW+ R + + D++L+ + W L RV ++ G D Sbjct: 462 FWRRWVREYLPLLQTRSKWKRVRRNVAVGDMILVVDDTKPRGSWDLSRVTAVYRGRDGCV 521 Query: 425 RVAELSTVNGIVRRALNRLVLL 490 R A + T + +V R +++L +L Sbjct: 522 RQARVKTKSSVVLRPVDKLCVL 543 >SB_3976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 54.8 bits (126), Expect = 2e-07 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 3/96 (3%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICEL--QQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCK 397 ++ I +FW R EY+ L + RSKW+ K R++++ D+VL+ + W LGRV + Sbjct: 635 VQTIVNYFWRRFIREYVPTLISRGRSKWQKKGRQMSVGDVVLLVDFTAPRGKWSLGRVVE 694 Query: 398 LFLGADNIPRVAELSTVNGI-VRRALNRLVLLPVSE 502 + G D + R + T NG +R++ R L+ +E Sbjct: 695 TYPGQDALVRNVRVKTANGAEYQRSVQRCCLICEAE 730 >SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) Length = 1935 Score = 54.8 bits (126), Expect = 2e-07 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 1/88 (1%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA-DNI 421 FW R T EY+ LQQR K ++++D+VL+ + + W L RV ++ + D + Sbjct: 1841 FWKRWTREYLPSLQQRQKGNKLRANVSVDDIVLVLDDSKPRSSWPLARVLEIHTSSNDGL 1900 Query: 422 PRVAELSTVNGIVRRALNRLVLLPVSEA 505 R +L T G++ R ++ +V+L +++A Sbjct: 1901 VRSVKLKTSTGVLVRPVDNIVMLEITDA 1928 >SB_11376| Best HMM Match : Agenet (HMM E-Value=0.69) Length = 228 Score = 54.0 bits (124), Expect = 3e-07 Identities = 28/95 (29%), Positives = 47/95 (49%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L D++L+++ W LGRV + Sbjct: 125 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLRAGDIILLRDETEHRNDWPLGRVTEAV 184 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D+ R A++ +VR + R+ L P+ E I Sbjct: 185 KSEDSRVRKAKVE----VVRDGVKRIYLRPIKELI 215 >SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) Length = 807 Score = 53.2 bits (122), Expect = 5e-07 Identities = 24/59 (40%), Positives = 30/59 (50%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLG 409 + H+W R EYI LQ+R KW + R L DLVL+ + N W LG V F G Sbjct: 745 LAHHYWRRWLKEYIPSLQERRKWHLPTRNLQAGDLVLVADDNVRRKKWPLGLVMNTFQG 803 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R TSEY+ L +R+KW L D+VL+ + N W L RV ++ + Sbjct: 1842 LSNRFWRRWTSEYLPTLMERTKWTTVRENLKEGDVVLLADENFRRGEWPLARVMEVLPSS 1901 Query: 413 DNIPRVAELSTVNGIVRRALNR 478 D R A + TV+ + RA R Sbjct: 1902 DGRVRSAMVKTVSTVATRAKRR 1923 >SB_25562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 52.8 bits (121), Expect = 7e-07 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIP 424 FW R +EY+ LQ+R +WR R + DLVL+ + W LGRV + G D Sbjct: 479 FWKRWIAEYLPTLQERQRWRKPRRNFQIGDLVLVADERVPRGHWPLGRVTAVCEGRDGYV 538 Query: 425 RVAELSTVN-GIVRRALNRLVLL 490 R + T N ++R + +L LL Sbjct: 539 RSVTVKTRNEAELKRPIAKLCLL 561 >SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) Length = 1898 Score = 52.8 bits (121), Expect = 7e-07 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRV 391 ++ + FWTR E++ LQ+R KW R L ND+VLIK N CW++ R+ Sbjct: 910 VQHLSNEFWTRWRKEFLTFLQERQKWVRPRRNLQENDIVLIKNDNAPRNCWKVARI 965 >SB_53674| Best HMM Match : rve (HMM E-Value=0.00095) Length = 263 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R TSEY+ L +R+KW L D+VL+ + N W L RV ++ + Sbjct: 176 LSNRFWRRWTSEYLPTLMERTKWTTVRENLKEGDVVLLADENFRRGEWPLARVMEVLPSS 235 Query: 413 DNIPRVAELSTVNGIVRRALNR 478 D R A + TV+ + RA R Sbjct: 236 DGRVRSAMVKTVSTVATRAKRR 257 >SB_45491| Best HMM Match : Agenet (HMM E-Value=1.4) Length = 228 Score = 52.4 bits (120), Expect = 9e-07 Identities = 28/95 (29%), Positives = 45/95 (47%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L D++L+++ W LGRV + Sbjct: 125 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLRAGDIILLRDETEHRNDWPLGRVTEAV 184 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D R A++ +VR + R L P+ E I Sbjct: 185 KSEDGRVRKAKVE----VVRDGVKRTYLRPIKELI 215 >SB_59447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 52.4 bits (120), Expect = 9e-07 Identities = 26/89 (29%), Positives = 49/89 (55%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ+R KW R + + D+VL+ + +T W+L +V ++ Sbjct: 984 VQYLTELFWSRWKKEYLQNLQKRHKWCDTKRNIAVGDIVLLADDDTPRGHWKLAKVIEVK 1043 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLL 490 + R A + T + R +++LVLL Sbjct: 1044 PDDRGLVRSARIKTATTTLERPVHKLVLL 1072 >SB_51460| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-33) Length = 1584 Score = 52.4 bits (120), Expect = 9e-07 Identities = 28/95 (29%), Positives = 45/95 (47%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L D++L+++ W LGRV + Sbjct: 1481 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLRAGDIILLRDETEHRNDWPLGRVTEAV 1540 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D R A++ +VR + R L P+ E I Sbjct: 1541 KSEDGRVRKAKVE----VVRDGVKRTYLRPIKELI 1571 >SB_51210| Best HMM Match : rve (HMM E-Value=2.2e-13) Length = 331 Score = 52.4 bits (120), Expect = 9e-07 Identities = 28/95 (29%), Positives = 45/95 (47%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L D++L+++ W LGRV + Sbjct: 228 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLRAGDIILLRDETEHRNDWPLGRVTEAV 287 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D R A++ +VR + R L P+ E I Sbjct: 288 KSEDGRVRKAKVE----VVRDGVKRTYLRPIKELI 318 >SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018) Length = 1066 Score = 52.4 bits (120), Expect = 9e-07 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 15/108 (13%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRV---- 391 ++ + FWTR E++ LQ+R KW R L ND+VLIK+ + CW++ R+ Sbjct: 959 VQHLANEFWTRWRKEFLTSLQERHKWVRPRRNLQENDIVLIKDDDALRNCWKVARISNAE 1018 Query: 392 ---------C-KLFLGADNIPRVAELSTVNGIVRRALNRLVLL-PVSE 502 C L LG N+ + + R +LVLL P SE Sbjct: 1019 PDDDGLVRHCVTLVLGTSNLSAKGQRREAPSTLERPAQKLVLLVPASE 1066 >SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) Length = 1034 Score = 52.4 bits (120), Expect = 9e-07 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIP 424 FW R +EY+ LQ+R +WR R + DLVL+ + W LGRV + G D Sbjct: 949 FWKRWIAEYLPTLQERQRWRKPRRNFQIGDLVLVADERVPRRHWPLGRVTAVCEGRDGYV 1008 Query: 425 RVAELSTVNGI-VRRALNRLVLL 490 R + T N ++R +L LL Sbjct: 1009 RSVTVKTRNETGLQRPFAKLCLL 1031 >SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 52.0 bits (119), Expect = 1e-06 Identities = 27/95 (28%), Positives = 46/95 (48%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L+ D++L+++ W +GRV + Sbjct: 1851 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLHAGDIILLRDKTEHRNDWPMGRVTEAV 1910 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D R A++ +VR + R L P+ E I Sbjct: 1911 KSEDGRVRKAKVE----VVRDGVKRTYLRPIKELI 1941 >SB_31806| Best HMM Match : rve (HMM E-Value=1.9e-07) Length = 353 Score = 52.0 bits (119), Expect = 1e-06 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +2 Query: 245 FWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA-DNI 421 FW R T EY+ LQQR K ++++D+VL+ + + W L RV ++ + D + Sbjct: 227 FWKRWTREYLPSLQQRQKGNKLRANVSVDDIVLVLDDSKPRSSWPLARVLEIHTSSNDGL 286 Query: 422 PRVAELSTVNGIVRRALNRLVLLPV 496 R +L T G++ R ++ +V+L + Sbjct: 287 VRSVKLKTSTGVLVRPVDNIVMLEI 311 >SB_52674| Best HMM Match : Peptidase_A17 (HMM E-Value=3.9e-07) Length = 729 Score = 50.4 bits (115), Expect = 4e-06 Identities = 26/84 (30%), Positives = 43/84 (51%) Frame = +2 Query: 227 EKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFL 406 +++ HFW R+ E + L R W + + + D+VLI E N + W LGR+ + Sbjct: 646 QRLVNHFWNRQHKECLHILSIRHIWMKEEVPVRVGDVVLISEDNVTRGQWPLGRIEAVHP 705 Query: 407 GADNIPRVAELSTVNGIVRRALNR 478 G D + R A + T G ++R + R Sbjct: 706 GKDGLIRTAMMRTEKGTLKRPVQR 729 >SB_31396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/93 (23%), Positives = 47/93 (50%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 +++I + FW R + L KWR + R + + D+V++ ++N W GRV +++ Sbjct: 579 VQRIVESFWKRWHRDVFPALVPTKKWRSEIRNVQVGDIVVVSDSNALRGKWSTGRVTEVY 638 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 G D R ++ T G R + ++ ++ ++ Sbjct: 639 PGPDGKVRNVKVQTATGKYSRPVTKIAVIQAAD 671 >SB_47175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1088 Score = 49.2 bits (112), Expect = 8e-06 Identities = 26/92 (28%), Positives = 44/92 (47%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + + FW R EY+ LQ R KW + R D+VL+K+ + W +GR+ + A Sbjct: 992 LAEQFWVRWRREYLQNLQPRRKWNEQQRNPQEGDIVLLKDDSAVRNNWPIGRISEAIKSA 1051 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D+ R ++ +VR + L P+ E + Sbjct: 1052 DDKVRKVKID----VVRDGEKKTYLRPIKELV 1079 >SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 49.2 bits (112), Expect = 8e-06 Identities = 26/92 (28%), Positives = 44/92 (47%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + + FW R EY+ LQ R KW + R D+VL+K+ + W +GR+ + A Sbjct: 1495 LAEQFWVRWRREYLQNLQPRRKWNEQQRNPQEGDIVLLKDDSAVRNNWPIGRISEAIKSA 1554 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D+ R ++ +VR + L P+ E + Sbjct: 1555 DDKVRKVKID----VVRDGEKKTYLRPIKELV 1582 >SB_932| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-11) Length = 665 Score = 48.8 bits (111), Expect = 1e-05 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +2 Query: 242 HFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNT--SPLCWRLGRVCKLFLGAD 415 H+W R EYI LQ+R KW + R L DLVL+ + N + R G + G D Sbjct: 576 HYWRRWLKEYIPSLQERRKWHLPTRNLQAGDLVLVADDNVRIKKMASRPGH--EHLSGRD 633 Query: 416 NIPRVAELSTVNGIVRRALNRLVLL 490 R E+ G +RR + ++ LL Sbjct: 634 GRVRNVEVRVDGGELRRPVTKICLL 658 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 48.0 bits (109), Expect = 2e-05 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 1/117 (0%) Frame = +2 Query: 242 HFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSP-LCWRLGRVCKLFLGADN 418 HFWT + L +R KW L DLVL E ++ P W++ V ++F G D Sbjct: 1812 HFWTAWMKYFAPTLLRRDKWYRPRDNLKSGDLVL--EVDSCPRRKWKMALVEEVFPGKDG 1869 Query: 419 IPRVAELSTVNGIVRRALNRLVLLPVSEAIDC*KLCGAFNGREDVGAVSSQSAAADM 589 R A++ T R +++L L+ E + K G+ G V+ +AAA + Sbjct: 1870 KVRKAKIKTQTSSFERPIHKLCLIATKEELSSMKPSGSVTVAVVGGGVAGLAAAASL 1926 >SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) Length = 1043 Score = 47.2 bits (107), Expect = 3e-05 Identities = 24/68 (35%), Positives = 33/68 (48%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + FW R E++ LQ KW R L +D+VLIKE WRL RV + Sbjct: 936 IQHLTNEFWCRWKREFLQSLQVLHKWIRPRRNLEQDDIVLIKEDKVPRNKWRLARVTSVI 995 Query: 404 LGADNIPR 427 DN+ R Sbjct: 996 QDEDNLVR 1003 >SB_37714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 46.8 bits (106), Expect = 5e-05 Identities = 26/94 (27%), Positives = 47/94 (50%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ I W+R EY+ L R+KW ++L ++VL + + W LGR+ + + Sbjct: 312 VQAIISKVWSRWQREYLPTLNTRAKWTKDMQDLKEGNVVLAMDPDLPRGRWPLGRIVETY 371 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEA 505 G D RVA++ + R + +LV L V ++ Sbjct: 372 PGQDGHTRVAKVQCGDKTYIRPITKLVPLEVRQS 405 >SB_7499| Best HMM Match : zf-CCHC (HMM E-Value=0.00029) Length = 846 Score = 46.4 bits (105), Expect = 6e-05 Identities = 29/95 (30%), Positives = 43/95 (45%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + + FW+R EY+ LQ R KW L ++L ET W LGRV + Sbjct: 726 VQYLAEQFWSRWRREYLQNLQPRQKWNGATESLRAGGIILRDETEHRN-DWPLGRVTEAV 784 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAI 508 D R A++ +VR + R L P+ E I Sbjct: 785 KSEDGRVRKAKVE----VVRDGVKRTYLRPIKELI 815 >SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1634 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/77 (27%), Positives = 39/77 (50%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 +++I + FW R + L KWR + R + + D+V++ ++N W GRV +++ Sbjct: 1459 VQRIVESFWKRWHRDVFPALLPTKKWRSEIRNVQVGDIVVVSDSNALRGKWSTGRVTEVY 1518 Query: 404 LGADNIPRVAELSTVNG 454 G D R ++ T G Sbjct: 1519 PGPDGKVRNVKVQTATG 1535 >SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) Length = 1541 Score = 46.0 bits (104), Expect = 8e-05 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + FW R EY +LQ R KW L D+VL+ + + W L + K+F Sbjct: 1267 VQYLANQFWLRWRREYCTQLQSRQKWNKPQPNLREGDVVLMTDPDLPRNQWPLAIISKVF 1326 Query: 404 LGADNIPRVAELST 445 DN+ R +++T Sbjct: 1327 PSKDNLVRKVQVTT 1340 >SB_19063| Best HMM Match : rve (HMM E-Value=3.6e-14) Length = 467 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 + FW R TSEY+ L +R+KW L D+VL+ + N W L RV ++ + Sbjct: 400 LSNRFWRRWTSEYLPTLMERTKWTTVRENLKEGDVVLLADENFRRGEWPLARVMEVLPSS 459 Query: 413 DNI 421 D + Sbjct: 460 DGV 462 >SB_13495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/74 (29%), Positives = 38/74 (51%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 ++ + FW+R EY+ LQ+R KW+ + + L + DLVL+K+ N W +G + + Sbjct: 68 IQYLANTFWSRWQKEYLVTLQERLKWQRERKNLKVGDLVLLKD-NAPRNVWEMGLIKETE 126 Query: 404 LGADNIPRVAELST 445 I R + T Sbjct: 127 EDPQGIVRAVTVKT 140 >SB_22757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/74 (32%), Positives = 40/74 (54%) Frame = +2 Query: 284 QQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNGIVR 463 Q+RSK + R +++ D+VL+ + W LGRV ++F D R A + T + I Sbjct: 1093 QRRSKSQRTRRNVSVGDIVLVVDDTMPRSKWGLGRVIEVFTAGDGCVRQARVRTRSSIFL 1152 Query: 464 RALNRLVLLPVSEA 505 R +++L +L EA Sbjct: 1153 RPIDKLCVLECDEA 1166 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 42.3 bits (95), Expect = 0.001 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +2 Query: 266 EYICEL--QQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAEL 439 EY+ L + RSKW+ + R++++ D+VL+ T W LGRV + + G D + R + Sbjct: 145 EYVLTLISRGRSKWQKEGRQMSVGDVVLLVGFTTLRGKWSLGRVVETYPGQDGLVRNVRV 204 Query: 440 STVNG 454 T +G Sbjct: 205 KTASG 209 >SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1359 Score = 42.3 bits (95), Expect = 0.001 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +2 Query: 266 EYICEL--QQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAEL 439 EY+ L + RSKW+ + R++++ D+VL+ T W LGRV + + G D + R + Sbjct: 309 EYVLTLISRGRSKWQKEGRQMSVGDVVLLVGFTTLRGKWSLGRVVETYPGQDGLVRNVRV 368 Query: 440 STVNG 454 T +G Sbjct: 369 KTASG 373 >SB_54444| Best HMM Match : zf-CCHC (HMM E-Value=0.035) Length = 671 Score = 40.7 bits (91), Expect = 0.003 Identities = 25/75 (33%), Positives = 36/75 (48%) Frame = +2 Query: 266 EYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELST 445 EY+ LQ+R KW R L DLVL+ + + W G V + F A R + + T Sbjct: 594 EYLPALQKRQKWLHPRRNLVARDLVLLADESCPRGQWPRGLVQETFANAFGHVRQSTVKT 653 Query: 446 VNGIVRRALNRLVLL 490 + RR + +L LL Sbjct: 654 STAVYRRDVRKLCLL 668 >SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) Length = 1494 Score = 40.7 bits (91), Expect = 0.003 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 2/89 (2%) Frame = +2 Query: 239 QHFWTRRTSEYICELQ--QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 QHFW R EY+ L+ + + + D+V I + L W+LG V L GA Sbjct: 69 QHFWQRWKQEYLTSLRCFHGATGGSGETRIKIGDVVQI-HSEKKRLNWKLGVVEDLIRGA 127 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVS 499 D R L T G R +++L L ++ Sbjct: 128 DGCVRAVTLKTAKGHTNRPISKLYPLEIT 156 >SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 3/90 (3%) Frame = +2 Query: 218 SLLEKIRQHF--WTR-RTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGR 388 +L I QH WTR R + + ++ R KW R L + D+V++K+ + W L R Sbjct: 375 TLRSAISQHAQKWTRPRRNLEVGDISTRQKWTRPRRNLEVGDIVIVKDESLHRNDWHLAR 434 Query: 389 VCKLFLGADNIPRVAELSTVNGIVRRALNR 478 V + F D + R +++ + + R R Sbjct: 435 VVEAFTSNDALLRFVKVAVGDSSLDRTGRR 464 >SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +2 Query: 248 WTR-RTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIP 424 WTR R + + ++ R KW R L + D+V++ + + WRL RV + F D + Sbjct: 188 WTRPRRNLEVGDISTRQKWTCPRRNLEVGDIVIVTDESLHRNDWRLARVVEAFTSHDGLV 247 Query: 425 RVAELS 442 R +++ Sbjct: 248 RSVKVA 253 >SB_27479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.5 bits (88), Expect = 0.007 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 2/89 (2%) Frame = +2 Query: 239 QHFWTRRTSEYICELQ--QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 QHFW R EY+ ++ + + + D+V I + L W+LG V L GA Sbjct: 10 QHFWQRWKQEYLTSMRCFHGATGGSGETRVKIGDVVQI-HSEKKRLKWKLGVVEDLIRGA 68 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVS 499 D R L T G R +++L L ++ Sbjct: 69 DGCVRAVTLKTAKGHTNRPISKLYPLEIT 97 >SB_23072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 39.1 bits (87), Expect = 0.009 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 2/83 (2%) Frame = +2 Query: 239 QHFWTRRTSEYICELQ--QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 QHFW R EY+ L+ + + + D+V I + L W+LG V L GA Sbjct: 425 QHFWQRWKQEYLTSLRCFHGATGGSGETRVKIGDVVQI-HSEKKRLKWKLGVVEDLIRGA 483 Query: 413 DNIPRVAELSTVNGIVRRALNRL 481 D R L T G R +++L Sbjct: 484 DGCVRAVALKTAKGHTNRPISKL 506 >SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1400 Score = 38.3 bits (85), Expect = 0.016 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +2 Query: 239 QHFWTRRTSEYICELQ--QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 QHFW R EY+ L+ + + + D+V I + L W+LG V L GA Sbjct: 1301 QHFWQRWKQEYLTSLRCFHGATGGSGETRVKIGDVVQI-HSEKKRLKWKLGVVEDLIRGA 1359 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVS 499 D + R L T G R +++L L ++ Sbjct: 1360 DGV-RAVTLKTAKGHTNRPISKLYPLEIT 1387 >SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1378 Score = 38.3 bits (85), Expect = 0.016 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +2 Query: 239 QHFWTRRTSEYICELQ--QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGA 412 QHFW R EY+ L+ + + + D+V I + L W+LG V L GA Sbjct: 1234 QHFWQRWKQEYLTSLRCFHGATGGSGETRVKIGDVVQI-HSEKKRLKWKLGVVEDLIRGA 1292 Query: 413 DNIPRVAELSTVNGIVRRALNRLVLLPVS 499 D + R L T G R +++L L ++ Sbjct: 1293 DGV-RAVTLKTAKGHTNRPISKLYPLEIT 1320 >SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) Length = 1290 Score = 37.9 bits (84), Expect = 0.021 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 1153 LIKCKDAVWKRWTDEYLSGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 1212 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D + R A+L + R + +L P+ +D Sbjct: 1213 LTTSKDGVVRGAKLRAGKSYIERPVQ--LLYPLELKVD 1248 >SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 37.9 bits (84), Expect = 0.021 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 1121 LIKCKDAVWKRWTDEYLSGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 1180 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D + R A+L + R + +L P+ +D Sbjct: 1181 LTTSKDGVVRGAKLRAGKSYIERPVQ--LLYPLELKVD 1216 >SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) Length = 757 Score = 37.5 bits (83), Expect = 0.028 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 1/88 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 531 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 590 Query: 401 FLGADNIPRVAELSTVNGIVRRALNRLV 484 G D V L N +R +L+ Sbjct: 591 IQGPDGQHEV--LVNANANAKRYRRKLI 616 >SB_19007| Best HMM Match : rve (HMM E-Value=2e-12) Length = 539 Score = 37.1 bits (82), Expect = 0.037 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 437 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 496 Query: 401 FLGADNIPRVAELSTVN 451 G D R A + ++ Sbjct: 497 IQGPDGQVRGAVIRVLS 513 >SB_52583| Best HMM Match : rve (HMM E-Value=0.00025) Length = 287 Score = 37.1 bits (82), Expect = 0.037 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 185 LAKKRRHFWNRWFKEYLVDLREQHKVVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 244 Query: 401 FLGADNIPRVAELSTVN 451 G D R A + ++ Sbjct: 245 IQGPDGQVRGAVIRVLS 261 >SB_15661| Best HMM Match : rve (HMM E-Value=3e-10) Length = 375 Score = 37.1 bits (82), Expect = 0.037 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 273 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 332 Query: 401 FLGADNIPRVAELSTVN 451 G D R A + ++ Sbjct: 333 IQGPDGQVRGAVIRVLS 349 >SB_8488| Best HMM Match : Kelch_1 (HMM E-Value=3.3e-13) Length = 485 Score = 37.1 bits (82), Expect = 0.037 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 65 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 124 Query: 401 FLGADNIPRVAELSTVN 451 G D R A + ++ Sbjct: 125 IQGPDGQVRGAVIRVLS 141 >SB_4534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 37.1 bits (82), Expect = 0.037 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 127 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 186 Query: 401 FLGADNIPRVAELSTVN 451 G D R A + ++ Sbjct: 187 IQGPDGQVRGAVIRVLS 203 >SB_26839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.7 bits (81), Expect = 0.048 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +2 Query: 242 HFWTRRTSEYICELQQ---RSKWRVKCRE-LNLNDLVLIKETNTSPLCWRLGRVCKLFLG 409 HFW R + EY+ L++ S+ + RE + + D+V + + + W++ V KL G Sbjct: 293 HFWKRWSKEYLASLREFYRSSRVTGRHREAVQVGDVVTVHDDGSKRSQWKMAVVEKLIKG 352 Query: 410 ADNIPRVAELSTV 448 D++ R A++ V Sbjct: 353 RDDVVRGAQVRLV 365 >SB_24920| Best HMM Match : HSP20 (HMM E-Value=5) Length = 221 Score = 36.7 bits (81), Expect = 0.048 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + ++ + ++V++K + W+LG V Sbjct: 84 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDIKPTIGEVVIVKSEEKNRGKWQLGIVSS 143 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D R A+L + R + +L P+ +D Sbjct: 144 LITSKDGEVRGAKLRAGKSYIERPVQ--LLYPLELKVD 179 >SB_37923| Best HMM Match : rve (HMM E-Value=1.2e-12) Length = 283 Score = 36.3 bits (80), Expect = 0.064 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 217 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 276 Query: 401 FLGAD 415 G D Sbjct: 277 IQGPD 281 >SB_25688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 36.3 bits (80), Expect = 0.064 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 38 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 97 Query: 401 FLGAD 415 G D Sbjct: 98 IQGPD 102 >SB_15755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 36.3 bits (80), Expect = 0.064 Identities = 16/69 (23%), Positives = 35/69 (50%) Frame = +2 Query: 296 KWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNGIVRRALN 475 KWR + R + + D+V++ ++N W V ++ G D R ++ TV G R + Sbjct: 34 KWRSEIRNVQVGDIVVVSDSNALRGKWSTEGVTEVHPGPDGKVRNVKVQTVTGKYSRPVT 93 Query: 476 RLVLLPVSE 502 ++ ++ ++ Sbjct: 94 KIAVIQAAD 102 >SB_11984| Best HMM Match : rve (HMM E-Value=2.3) Length = 212 Score = 36.3 bits (80), Expect = 0.064 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL-NLNDLVLIKETNTSPLCWRLGRVCKL 400 L K R+HFW R EY+ +L+++ K R++ + D+VL+ + W++ V +L Sbjct: 146 LAKKRRHFWNRWFKEYLVDLREQHKAVNSGRKVAEVGDVVLLFDETLKRSEWKMAVVEEL 205 Query: 401 FLGAD 415 G D Sbjct: 206 IQGPD 210 >SB_3018| Best HMM Match : Cathelicidins (HMM E-Value=5.9) Length = 71 Score = 35.9 bits (79), Expect = 0.085 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +2 Query: 287 QRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNGIVRR 466 +R+KW L D+VL+ + N W L RV ++ +D R A + TV+ + R Sbjct: 2 ERTKWTTVRENLKEGDVVLLADENFRRGEWPLARVMEVLPSSDGRVRSAMVKTVSTVATR 61 Query: 467 ALNR 478 A R Sbjct: 62 AKRR 65 >SB_40650| Best HMM Match : PAM2 (HMM E-Value=6.6) Length = 290 Score = 35.5 bits (78), Expect = 0.11 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 117 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 176 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D R A+L + R + +L P+ +D Sbjct: 177 LITSKDGEVRGAKLRAGKSYIERPVQ--LLYPLELKVD 212 >SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) Length = 1461 Score = 35.5 bits (78), Expect = 0.11 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 1324 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 1383 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D R A+L + R + +L P+ +D Sbjct: 1384 LITSKDGEVRGAKLRAGKSYIERPVQ--LLYPLELKVD 1419 >SB_3390| Best HMM Match : PAM2 (HMM E-Value=1.6) Length = 240 Score = 35.5 bits (78), Expect = 0.11 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 117 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 176 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D R A+L + R + +L P+ +D Sbjct: 177 LITSKDGEVRGAKLRAGKSYIERPVQ--LLYPLELKVD 212 >SB_31254| Best HMM Match : rve (HMM E-Value=5.2e-15) Length = 341 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 244 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 303 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 304 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 340 >SB_21620| Best HMM Match : C1_1 (HMM E-Value=4.7) Length = 254 Score = 35.1 bits (77), Expect = 0.15 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 2/98 (2%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQR--SKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R +K + + ++V++K + W+LG V Sbjct: 117 LIKCKDAVWKRWTDEYLRGLRERHPAKTGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 176 Query: 398 LFLGADNIPRVAELSTVNGIVRRALNRLVLLPVSEAID 511 L D R A L ++R + +L P+ +D Sbjct: 177 LITSKDGEVRGANLRVGKSYIKRPVQ--LLYPLELKVD 212 >SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1626 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 1481 IQRSKEDLKKRFTREYVQSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 1540 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 1541 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 1577 >SB_15838| Best HMM Match : Peptidase_A17 (HMM E-Value=7.9e-32) Length = 1027 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 852 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 911 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 912 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 948 >SB_13977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 763 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 624 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 683 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 684 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 720 >SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1358 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 1219 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 1278 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 1279 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 1315 >SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) Length = 1485 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 1381 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 1440 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 1441 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 1477 >SB_1129| Best HMM Match : PAM2 (HMM E-Value=0.028) Length = 235 Score = 35.1 bits (77), Expect = 0.15 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGR 388 +++ ++ R T EY+ L++R + + +L + + +VL+KE + W++GR Sbjct: 96 IQRSKEDLKKRFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGR 155 Query: 389 VCKLFLGADNIPRVAELSTVNG-IVRRALNRLVLLPV 496 V + G D + R +L NG ++ R L + L + Sbjct: 156 VVEKITGRDGVVRGVKLKMGNGYVIERPLQLICDLEI 192 >SB_57991| Best HMM Match : rve (HMM E-Value=1.1e-10) Length = 314 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 6/87 (6%) Frame = +2 Query: 254 RRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGRVCKLFLGADN 418 R T EY+ L++R + + +L + + +VL+KE + W++GRV + G D Sbjct: 227 RFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGRVVEKITGRDG 286 Query: 419 IPRVAELSTVNG-IVRRALNRLVLLPV 496 + R +L NG ++ R L + L + Sbjct: 287 VVRGVKLKMGNGYVIERPLQLICDLEI 313 >SB_45156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 6/87 (6%) Frame = +2 Query: 254 RRTSEYICELQQRSKWRVKC--RELNLND---LVLIKETNTSPLCWRLGRVCKLFLGADN 418 R T EY+ L++R + + +L + + +VL+KE + W++GRV + G D Sbjct: 268 RFTREYVRSLEERQQKHEERSGEQLKVPEKGRVVLLKEDVKNKAQWKIGRVVEKITGRDG 327 Query: 419 IPRVAELSTVNG-IVRRALNRLVLLPV 496 + R +L NG ++ R L + L + Sbjct: 328 VVRGVKLKMGNGYVIERPLQLICDLEI 354 >SB_52435| Best HMM Match : RYDR_ITPR (HMM E-Value=1.4) Length = 954 Score = 32.7 bits (71), Expect = 0.79 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +2 Query: 239 QHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADN 418 + FW R E++ L K R L + D+V++ + W L RV + F D Sbjct: 769 KQFWNRWRKEFLFSLSTHQKSTRPGRNLKVGDIVVVNVESLHCNDWCLARVVEAFTSHDG 828 Query: 419 IPR 427 + R Sbjct: 829 LVR 831 >SB_29621| Best HMM Match : Halo_GVPC (HMM E-Value=5.3) Length = 471 Score = 31.5 bits (68), Expect = 1.8 Identities = 20/65 (30%), Positives = 28/65 (43%) Frame = -1 Query: 537 LKAPHSFQQSMASETGRSTRRFSARRTIPLTVLNSATLGMLSAPRNSLHTLPNLQQRGDV 358 LK H F+Q + ET TR+ S + L V TL + H P Q+ + Sbjct: 254 LKLSHDFEQIQSDETAVETRKSSFQELNDLVVQEPTTLQDANRLTPEFHLEPRFQELPNY 313 Query: 357 LVSLI 343 VS+I Sbjct: 314 HVSVI 318 >SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) Length = 984 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/64 (28%), Positives = 35/64 (54%) Frame = -1 Query: 360 VLVSLIKTKSLRFSSLHFTRHLDLCCSSQMYSEVRRVQKCCRIFSRSDYGKNITDKTIVR 181 V+ SL+KT +R +H R + C SS M ++RR++ C ++ ++ D + ++ Sbjct: 517 VVRSLLKTIDIR--RVHRQRSMLNCASSLMMIDIRRLRPCAKL-AKDDRYSTLVRSSLKM 573 Query: 180 ISVR 169 I +R Sbjct: 574 IDIR 577 >SB_45299| Best HMM Match : AIG2 (HMM E-Value=1.7) Length = 162 Score = 31.1 bits (67), Expect = 2.4 Identities = 21/93 (22%), Positives = 43/93 (46%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 +++I + FW R + L KWR + R N+++ + K W GRV +++ Sbjct: 76 VQRIVESFWKRWHRDVFPVLVPTKKWRSEIR--NVSNALRGK--------WSTGRVTEVY 125 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 G D R ++ T G R + ++ ++ ++ Sbjct: 126 PGPDGKVRNVKVQTATGKYSRPVTKIAVIQAAD 158 >SB_21352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +2 Query: 320 LNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNGIVRRALNRLVLLPVS 499 + + D+V I + L W+LG V L GAD R L TV G R ++L L ++ Sbjct: 342 VKIGDVVQIP-SEKKRLKWKLGVVEDLIRGADGCLRAVTLKTVKGPRNRPFSKLYPLEIT 400 >SB_7238| Best HMM Match : rve (HMM E-Value=0.0017) Length = 367 Score = 31.1 bits (67), Expect = 2.4 Identities = 21/93 (22%), Positives = 43/93 (46%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKLF 403 +++I + FW R + L KWR + R N+++ + K W GRV +++ Sbjct: 281 VQRIVESFWKRWHRDVFPVLVPTKKWRSEIR--NVSNALRGK--------WSTGRVTEVY 330 Query: 404 LGADNIPRVAELSTVNGIVRRALNRLVLLPVSE 502 G D R ++ T G R + ++ ++ ++ Sbjct: 331 PGPDGKVRNVKVQTATGKYSRPVTKIAVIQAAD 363 >SB_54682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 233 IRQHFWTRRTSEYICELQQRSKW 301 + FW R TSEY+ L +R+KW Sbjct: 88 LSNRFWRRWTSEYLPTLMERTKW 110 >SB_57360| Best HMM Match : Peptidase_A17 (HMM E-Value=8.9e-29) Length = 1354 Score = 30.3 bits (65), Expect = 4.2 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ L++R + + + + ++V++K + W+LG V Sbjct: 870 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 929 Query: 398 LFLGAD 415 L D Sbjct: 930 LITSKD 935 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 136 IFINKNTFNLYHGQPTCFLXLVPNXLQPGGXH*XLERPPPR 14 +FI+KN + C V N PG LERPPPR Sbjct: 193 VFIHKNLMKIISSPEICKTVNVSNSCSPGDPL-VLERPPPR 232 >SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1303 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 227 EKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKE 352 + I W R +Y+ L R KW + L + DLV++K+ Sbjct: 1262 QTIADMVWHRWRKDYLPTLTVRKKWNKEETNLRVGDLVIVKD 1303 >SB_8626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 30.3 bits (65), Expect = 4.2 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 317 ELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNGIVRRALNR 478 +LN D+VL+ + N W L RV ++ D R A + TV+ + R R Sbjct: 164 DLNEGDVVLLADENYPRGEWPLARVLEVLPSGDGHVRRARVKTVSTVATRVKRR 217 >SB_51890| Best HMM Match : BCCT (HMM E-Value=0) Length = 677 Score = 29.9 bits (64), Expect = 5.6 Identities = 22/71 (30%), Positives = 30/71 (42%) Frame = -1 Query: 495 TGRSTRRFSARRTIPLTVLNSATLGMLSAPRNSLHTLPNLQQRGDVLVSLIKTKSLRFSS 316 T RRF R +P+ + T G R ++ G + + LRFSS Sbjct: 549 TAARQRRFPGRSVVPVPL----TTGF----RVRFPVTTRVELVGHAFAPRVFLRVLRFSS 600 Query: 315 LHFTRHLDLCC 283 LH T +LDL C Sbjct: 601 LHKTNNLDLSC 611 >SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) Length = 1595 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 314 RELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPR 427 R L ND+VLIK + CW++ R+ D + R Sbjct: 1519 RNLQENDIVLIKNDDVPRNCWKVARISNAEPDEDGLVR 1556 >SB_19470| Best HMM Match : rve (HMM E-Value=0.0029) Length = 347 Score = 29.5 bits (63), Expect = 7.4 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLGRVCK 397 L K + W R T EY+ +++R + + + + ++V++K + W+LG V Sbjct: 252 LIKCKDAVWKRWTDEYLRGIRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIVSS 311 Query: 398 LFLGAD 415 L D Sbjct: 312 LITSKD 317 >SB_22271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 29.1 bits (62), Expect = 9.7 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCREL--NLNDLVLIKETNTSPLCWRLG---- 385 L K + W R T EY+ L++R + + + + ++V++K + W+LG Sbjct: 53 LIKCKDAVWKRWTDEYLRGLRERHRAKAGAPDTKPTIGEVVIVKSEEKNRGKWQLGIQGR 112 Query: 386 RVCKLFLGADNIPRVAEL 439 R KL G I R +L Sbjct: 113 RGAKLRAGKSYIERPVQL 130 >SB_14900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +2 Query: 224 LEKIRQHFWTRRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRL 382 +++I F R + + + R KW V+ R +N++V++ E N W + Sbjct: 131 VQRIVDSFCKRWSRDVFPSVVPRKKWTVENRNAQVNEMVILSEPNVIRGKWSI 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,447,301 Number of Sequences: 59808 Number of extensions: 628110 Number of successful extensions: 1679 Number of sequences better than 10.0: 97 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1672 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4906390786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -