BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_C02_e11_06.seq (1512 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 3.9 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 9.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 9.1 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +2 Query: 605 DQSRERCYQRQKRFPLNGQTRIKNNAFRNYQQFFNNIFYCNKQV 736 ++SR+R + + R P + N + NY + NN NK++ Sbjct: 65 ERSRDRTERERSREPKIISSLSNNYNYSNYNNYNNNYNNYNKKL 108 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 166 KFYFYIDNLKIFINKNTFNLYHGQPTCFLXLVPNXLQP 53 K+++ IDN + +N + CF + N L+P Sbjct: 538 KYFYEIDNWMLDLNSGLNKITRNSLDCFFTM--NDLEP 573 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 166 KFYFYIDNLKIFINKNTFNLYHGQPTCFLXLVPNXLQP 53 K+++ IDN + +N + CF + N L+P Sbjct: 538 KYFYEIDNWMLDLNSGLNKITRNSLDCFFTM--NDLEP 573 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 325,346 Number of Sequences: 438 Number of extensions: 6842 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52874250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -