BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_C02_e11_06.seq (1512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44130.1 68414.m05097 nucellin protein, putative similar to n... 30 4.6 At5g16230.1 68418.m01896 acyl-[acyl-carrier-protein] desaturase,... 29 8.0 At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A... 29 8.0 At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A... 29 8.0 >At1g44130.1 68414.m05097 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 405 Score = 29.9 bits (64), Expect = 4.6 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 317 ELNLNDLVLIKETNTSPLCWRLGRVCKLFLGADNIPRVAELSTVNG 454 +L ++ L + KE T P+CW+ + K L N + ++ NG Sbjct: 288 DLKVSPLKVAKEDKTLPICWKGAKPFKSVLEVKNFFKTITINFTNG 333 >At5g16230.1 68418.m01896 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Spinacia oleracea SP|P28645, Ricinus communis SP|P22337; contains Pfam profile PF03405 Fatty acid desaturase Length = 401 Score = 29.1 bits (62), Expect = 8.0 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +2 Query: 254 RRTSEYICELQQRSKWRVKCRELNLNDLVLIKETNTSPLCWRLGRVCKL 400 RR EY+C L Q R+K E ND V + + W GR KL Sbjct: 357 RRAQEYLCTLPQ----RIKRLEERANDRVKLVSKPSVSFSWVFGRDVKL 401 >At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 29.1 bits (62), Expect = 8.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 261 VRRVQKCCRIFSRSDYGKNITDKTIVR 181 VR++ CC +F SD KN+ +K I R Sbjct: 89 VRKLSLCCVVFDFSDPTKNVKEKDIKR 115 >At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 29.1 bits (62), Expect = 8.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 261 VRRVQKCCRIFSRSDYGKNITDKTIVR 181 VR++ CC +F SD KN+ +K I R Sbjct: 89 VRKLSLCCVVFDFSDPTKNVKEKDIKR 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,105,233 Number of Sequences: 28952 Number of extensions: 446826 Number of successful extensions: 930 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4038570048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -