BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B11_e82_03.seq (1544 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 3.4 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 25 5.9 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 3.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 48 HXPGXAGNSARGTKVXTILLKLSNRYVMQKYFMHL 152 H PG + TI L+ R+ KYF+HL Sbjct: 2043 HSPGALTDLRSALVNNTIFASLAVRHGFHKYFLHL 2077 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 25.0 bits (52), Expect = 5.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 407 SFC*FLNVHGVMWYYVLSSYILLAKKITH*LIHSHIR 517 S C FL H V W + +A+ +TH +H I+ Sbjct: 202 SLCDFLKAHTVSWTELCKIATTMARGLTH--LHEEIQ 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 969,479 Number of Sequences: 2352 Number of extensions: 13688 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 181658565 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -