BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B10_e74_04.seq (1430 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0976 - 29341981-29342229,29342388-29342621,29342771-293430... 33 0.73 06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785... 30 3.9 12_02_0776 - 23064167-23064239,23065214-23065518,23065614-230657... 29 6.8 11_01_0724 + 5981680-5981748,5982301-5982397,5982496-5982593,598... 29 6.8 03_05_1070 + 30125131-30127029 29 6.8 >03_05_0976 - 29341981-29342229,29342388-29342621,29342771-29343046, 29343181-29343457,29343549-29343847,29344021-29344152, 29344451-29344660,29344812-29344875,29346114-29346260, 29346477-29346760 Length = 723 Score = 32.7 bits (71), Expect = 0.73 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 328 RDRYLSFFNNESENDMSELDRDQIDTGAQRIINTCSHLLKEFRNDNRKVSVSDQTR 495 R R+ S FN+ S D+ E+DRD +G I+ HLL + + S +R Sbjct: 628 RHRFSSIFNSFSAQDLIEMDRDDEQSGRMEEIH--KHLLDAYSQGTTNMDNSSSSR 681 >06_03_0924 - 25976629-25976979,25977471-25978424,25978512-25978565, 25979135-25979254,25979357-25979532,25979624-25980107, 25980541-25980744,25981671-25981877,25982179-25982271, 25982433-25982621,25983364-25983423,25983591-25983927, 25984195-25984432,25984614-25984816,25985549-25986554, 25987125-25987290,25987715-25987824,25987944-25988195, 25988360-25988402,25988488-25988550,25989512-25989624, 25990787-25990838 Length = 1824 Score = 30.3 bits (65), Expect = 3.9 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -2 Query: 538 LNMHLLDLSRHPCI-HVFDQRLKLCDY 461 LN H +L+RHP I + D+ L+LCDY Sbjct: 1780 LNAHTYNLNRHPHIPPLADELLELCDY 1806 >12_02_0776 - 23064167-23064239,23065214-23065518,23065614-23065727, 23065812-23065918,23065997-23066143,23066227-23066326, 23066421-23066522,23066702-23066776,23066973-23067152, 23067266-23067355,23067435-23067559,23067847-23067910, 23067993-23068197,23068818-23068966 Length = 611 Score = 29.5 bits (63), Expect = 6.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 275 AVVMKPFFVLLLSKRCLSSLTGLCIPNALLRVRTVFIQALNSGV 144 AVV+KP+F+ L++ + L GL + A+ R V + N V Sbjct: 236 AVVLKPWFIALVAAGAIERLAGLALGVAMERDWVVLLAGTNRPV 279 >11_01_0724 + 5981680-5981748,5982301-5982397,5982496-5982593, 5983535-5983690,5983986-5984063,5984135-5984266, 5984856-5984936,5985442-5985510,5985597-5985686, 5986001-5986145,5986218-5986276,5986384-5986479, 5986561-5986628,5986704-5986803,5986910-5986966, 5987179-5987337 Length = 517 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 377 PSWTAIK*TLGPKESSIHVLTY*KSSGMIIAKF 475 PS T I TLGP S+ V+ ++GM +A+F Sbjct: 27 PSLTKIVGTLGPNSHSVEVIQECLTAGMAVARF 59 >03_05_1070 + 30125131-30127029 Length = 632 Score = 29.5 bits (63), Expect = 6.8 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +1 Query: 472 VSVSDQTREYMDAVIDLVDAYLKAVCKIHSELKALRVKRALDIRKLS 612 +++ D R Y D V VD YLKA ++ +E + RV +D RKL+ Sbjct: 405 LALPDHARVYDDGVYRAVDIYLKAHPRLAAEERD-RVCGVVDCRKLT 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,408,725 Number of Sequences: 37544 Number of extensions: 388344 Number of successful extensions: 728 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4536424228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -