BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B10_e74_04.seq (1430 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045639-1|AAC02565.1| 672|Caenorhabditis elegans Hypothetical ... 29 6.1 >AF045639-1|AAC02565.1| 672|Caenorhabditis elegans Hypothetical protein B0212.3 protein. Length = 672 Score = 29.5 bits (63), Expect = 6.1 Identities = 23/111 (20%), Positives = 54/111 (48%), Gaps = 1/111 (0%) Frame = +1 Query: 166 IKTVRTRNKAFGIQSPVSEDKQRLLRSKTKNGFITTA-KDICSQITRLRDFLLEHRDRYL 342 IKT + + + +E K++ R +K+G+ K + +++ ++ +E R R + Sbjct: 264 IKTTKEAVEPMRVWLVHNEFKRQEGRKFSKSGYAKRFHKKLAPNMSKWTNYKIEERTRMM 323 Query: 343 SFFNNESENDMSELDRDQIDTGAQRIINTCSHLLKEFRNDNRKVSVSDQTR 495 + E+D QI+ + ++ +HL+ ++ + NRK+ + +TR Sbjct: 324 FAMKGKVESDFLA----QIEESGKVQLDE-NHLIVKYTSKNRKIKLGGETR 369 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,642,344 Number of Sequences: 27780 Number of extensions: 384722 Number of successful extensions: 828 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 4079417776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -