BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B06_e42_04.seq (1469 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 128 7e-42 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 8e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 8e-09 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 56 5e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 54 3e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 52 1e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 52 1e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 52 1e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 8e-06 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 1e-04 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 45 1e-04 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 45 1e-04 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 45 1e-04 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 45 2e-04 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 44 2e-04 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 44 3e-04 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 44 3e-04 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 44 3e-04 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 44 3e-04 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 44 4e-04 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 44 4e-04 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 44 4e-04 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 44 4e-04 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 44 4e-04 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 44 4e-04 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 44 4e-04 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 44 4e-04 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 44 4e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 44 4e-04 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 44 4e-04 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 44 4e-04 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 44 4e-04 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 44 4e-04 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 44 4e-04 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 44 4e-04 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 44 4e-04 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 44 4e-04 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 44 4e-04 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 44 4e-04 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 44 4e-04 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 44 4e-04 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 44 4e-04 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 44 4e-04 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 44 4e-04 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 44 4e-04 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 44 4e-04 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 44 4e-04 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 44 4e-04 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 44 4e-04 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 44 4e-04 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 44 4e-04 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 44 4e-04 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 44 4e-04 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 44 4e-04 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 44 4e-04 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 44 4e-04 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 44 4e-04 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 44 4e-04 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 44 4e-04 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 44 4e-04 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 44 4e-04 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 44 4e-04 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 44 4e-04 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 44 4e-04 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 44 4e-04 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 44 4e-04 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 44 4e-04 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 44 4e-04 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 44 4e-04 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 44 4e-04 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 44 4e-04 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 44 4e-04 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 44 4e-04 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 44 4e-04 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 44 4e-04 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 44 4e-04 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 44 4e-04 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 44 4e-04 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 44 4e-04 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 44 4e-04 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 44 4e-04 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 44 4e-04 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 44 4e-04 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 44 4e-04 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 44 4e-04 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 44 4e-04 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 44 4e-04 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 44 4e-04 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 44 4e-04 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 44 4e-04 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 44 4e-04 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 44 4e-04 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 44 4e-04 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 44 4e-04 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 44 4e-04 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 44 4e-04 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 44 4e-04 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 44 4e-04 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 44 4e-04 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-04 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 43 7e-04 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 41 0.002 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 40 0.004 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 40 0.005 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 40 0.007 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 39 0.012 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_44498| Best HMM Match : BA14K (HMM E-Value=7) 39 0.012 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.015 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.015 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 38 0.015 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.015 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 38 0.015 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 38 0.015 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 38 0.015 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 38 0.015 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 38 0.015 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 38 0.015 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 128 bits (308), Expect(2) = 7e-42 Identities = 61/86 (70%), Positives = 75/86 (87%) Frame = +2 Query: 122 NSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVV 301 NSD+KAQLRELYI+ AKEI++ KK+III+VP+P+++AFQKIQ RLVRELEKKFSGKHVV Sbjct: 36 NSDMKAQLRELYISSAKEIDVGGKKAIIIFVPVPQIRAFQKIQTRLVRELEKKFSGKHVV 95 Query: 302 FVGDRKILPKPSHKTRVANKQKRPRS 379 V R+ILP+P+ K+R KQKRPRS Sbjct: 96 IVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect(2) = 7e-42 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 491 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 592 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.7 bits (153), Expect = 9e-11 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +3 Query: 684 IRPIVSRITIHWPSFLQRRDWENPGVTQLNSAXQXXP 794 IRPIVSRITIHWPSF +RRDWENPGV QLN P Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPP 54 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.7 bits (138), Expect = 6e-09 Identities = 33/56 (58%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -1 Query: 845 GRS-GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 GR+ G GLF RG + IKLGNA VFP + KRRPVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAI-TPAGERGMCCKA-IKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 59.3 bits (137), Expect = 8e-09 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 696 VSRITIHWPSFLQRRDWENPGVTQLNSAXQXXP 794 +SRITIHWPS LQRRDWENPGVTQLN P Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPP 309 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 8e-09 Identities = 31/52 (59%), Positives = 33/52 (63%) Frame = -1 Query: 836 GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 G GLF RG + IKLGNA VFP + KRRPVNCNTTHYRANW Sbjct: 4 GAGLFAI-TPAGERGMCCKA-IKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 56.8 bits (131), Expect = 4e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 773 IKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 IKLGNA+ FP + KRRPVNCNTTHYRANW Sbjct: 29 IKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 56.8 bits (131), Expect = 4e-08 Identities = 29/56 (51%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -1 Query: 845 GRS-GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 GR+ G GLF +G L +KLG + FP + KRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAI-TPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 56.4 bits (130), Expect = 5e-08 Identities = 32/56 (57%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -1 Query: 845 GRS-GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 GR+ G GLF RG S IKL +A VFP + KRRPVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAI-TPAGERGMCCKS-IKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 54.0 bits (124), Expect = 3e-07 Identities = 33/55 (60%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -1 Query: 845 GRS-GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 GRS G GLF RG + IKLGNAR FP KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAI-TPAGERGMCCKA-IKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 52.0 bits (119), Expect = 1e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -1 Query: 857 NXWEGRS--GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 N WEGRS L R AK G R+ G FP + KRRPVNCNTTHYRAN Sbjct: 596 NCWEGRSVRASSLLRQLAK----GGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRAN 647 Query: 683 W 681 W Sbjct: 648 W 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 52.0 bits (119), Expect = 1e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -1 Query: 857 NXWEGRS--GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 N WEGRS L R AK G R+ G FP + KRRPVNCNTTHYRAN Sbjct: 39 NCWEGRSVRASSLLRQLAK----GGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRAN 90 Query: 683 W 681 W Sbjct: 91 W 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 52.0 bits (119), Expect = 1e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -1 Query: 857 NXWEGRS--GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 N WEGRS L R AK G R+ G FP + KRRPVNCNTTHYRAN Sbjct: 39 NCWEGRSVRASSLLRQLAK----GGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRAN 90 Query: 683 W 681 W Sbjct: 91 W 91 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 51.6 bits (118), Expect = 2e-06 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -1 Query: 806 LAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 LA RG + IKLGNA VF + KRRPVNCNTTHYRAN Sbjct: 1 LAERGMCCKA-IKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.0 bits (114), Expect = 5e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -1 Query: 857 NXWEGRS--GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRAN 684 N WEGRS L R AK L S + G FP + KRRPVNCNTTHYRAN Sbjct: 25 NCWEGRSVRASSLLRQLAKGGCAARRL-SWVTPG----FPSHDVVKRRPVNCNTTHYRAN 79 Query: 683 W 681 W Sbjct: 80 W 80 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.2 bits (112), Expect = 8e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 808 SWXKGGXCCXAELSWVTPGFSQSRRCK 728 SW KGG C LSWVTPGFSQSRRCK Sbjct: 79 SWRKGG-CAARRLSWVTPGFSQSRRCK 104 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.4 bits (110), Expect = 1e-05 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +3 Query: 699 SRITIHWPSFLQRRDWENPGVTQLNSAXQXXP 794 SRITIHWPSF WENPGVTQLN P Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPP 33 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 48.0 bits (109), Expect = 2e-05 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -1 Query: 761 NARVFPVTTL*KRRPVNCNTTHYRANW 681 +A VFP + KRRPVNCNTTHYRANW Sbjct: 33 HAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 47.6 bits (108), Expect = 3e-05 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 845 GRS-GGGLFRYYAKLAXRGXXLXSRIKLGNARVFPVTTL*KRRPVNCNTTHYRANW 681 GR+ G GLF RG + IKL VFP + KRRPVNCNTTHYRANW Sbjct: 1847 GRAIGAGLFAI-TPAGERGMCCKA-IKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 45.6 bits (103), Expect(2) = 4e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 749 FPVTTL*KRRPVNCNTTHYRANW 681 FP + KRRPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 Score = 20.6 bits (41), Expect(2) = 4e-05 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 857 NXWEGRSG 834 N WEGRSG Sbjct: 50 NCWEGRSG 57 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -2 Query: 862 AQTXGKGDXGGXXFVITPSWXKGGXCCXAELSWVTPGFSQSRRCK 728 AQ GKGD G SW KG LSWVTPGFSQSRRCK Sbjct: 2 AQLLGKGDRCGPLRYYA-SWRKGDVL-QRRLSWVTPGFSQSRRCK 44 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 46.0 bits (104), Expect = 8e-05 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -2 Query: 856 TXGKGDXGGXXFVITPSWXKGGXCCXAELSWVTPGFSQSRRCK 728 T GKGD G SW KG LSWVTPGFSQSRRCK Sbjct: 4 TVGKGDRCGPLRYYA-SWRKGDVL-QGRLSWVTPGFSQSRRCK 44 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 45.6 bits (103), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 749 FPVTTL*KRRPVNCNTTHYRANW 681 FP + KRRPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 45.6 bits (103), Expect = 1e-04 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = +3 Query: 660 TRGGARYPIRPIVSRITIHWPSFLQRRDWENPGVTQLNSAXQXXP 794 T GGA PIRPIVSRITIHWP+F + TQLN P Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPP 76 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPP 665 KGG C LSWVTPGFSQSRRCK + L + G PP Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK + L + G P R+ Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCPQRL 89 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/47 (48%), Positives = 27/47 (57%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK +L ++ R PR+ Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRI 86 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK + L + G P R Sbjct: 120 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGPKR 164 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/47 (48%), Positives = 27/47 (57%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK +L ++ R P+V Sbjct: 54 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKV 96 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/47 (48%), Positives = 27/47 (57%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK +L ++ R PR+ Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPRL 86 >SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSR CK +L G++ YR R Sbjct: 66 KGG-CAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDYRGSLR 107 >SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSR CK +L G++ YR R Sbjct: 66 KGG-CAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDYRGSLR 107 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIG 689 KGG C LSWVTPGFSQSRRCK + L +G Sbjct: 471 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/47 (46%), Positives = 27/47 (57%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK +L ++ R P++ Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPKI 64 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK + L + G PR Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPQGPR 66 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/45 (51%), Positives = 25/45 (55%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPP 665 KGG C LSWVTPGFSQSRRCK + L + G A P Sbjct: 15 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPAVP 58 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/47 (48%), Positives = 27/47 (57%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPRV 659 KGG C LSWVTPGFSQSRRCK +L ++ R P+V Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPQV 64 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK + L + G P R Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPPVR 66 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 185 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 226 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 729 LQRRDWENPGVTQLNSAXQXXP 794 LQRRDWENPGVTQLN P Sbjct: 53 LQRRDWENPGVTQLNRLAAHPP 74 >SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 63 >SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 3 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 44 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 85 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 63 >SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCKNDGQ*IVIRLTIGRIGYRAPPR 662 KGG C LSWVTPGFSQSRRCK +L ++ R PR Sbjct: 253 KGG-CAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPR 294 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 497 KGG-CAARRLSWVTPGFSQSRRCK 519 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 167 KGG-CAARRLSWVTPGFSQSRRCK 189 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 29 KGG-CAARRLSWVTPGFSQSRRCK 51 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 244 KGG-CAARRLSWVTPGFSQSRRCK 266 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 388 KGG-CAARRLSWVTPGFSQSRRCK 410 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 241 KGG-CAARRLSWVTPGFSQSRRCK 263 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 90 KGG-CAARRLSWVTPGFSQSRRCK 112 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 671 KGG-CAARRLSWVTPGFSQSRRCK 693 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 909 KGG-CAARRLSWVTPGFSQSRRCK 931 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 177 KGG-CAARRLSWVTPGFSQSRRCK 199 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 21 KGG-CAARRLSWVTPGFSQSRRCK 43 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 396 KGG-CAARRLSWVTPGFSQSRRCK 418 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 245 KGG-CAARRLSWVTPGFSQSRRCK 267 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 312 KGG-CAARRLSWVTPGFSQSRRCK 334 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 580 KGG-CAARRLSWVTPGFSQSRRCK 602 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 427 KGG-CAARRLSWVTPGFSQSRRCK 449 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 378 KGG-CAARRLSWVTPGFSQSRRCK 400 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 204 KGG-CAARRLSWVTPGFSQSRRCK 226 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 729 LQRRDWENPGVTQLNSAXQXXP 794 LQRRDWEN GVTQLN P Sbjct: 519 LQRRDWENTGVTQLNRLAAHPP 540 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 810 KGG-CAARRLSWVTPGFSQSRRCK 832 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 70 KGG-CAARRLSWVTPGFSQSRRCK 92 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 90 KGG-CAARRLSWVTPGFSQSRRCK 112 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 29 KGG-CAARRLSWVTPGFSQSRRCK 51 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 36 KGG-CAARRLSWVTPGFSQSRRCK 58 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 29 KGG-CAARRLSWVTPGFSQSRRCK 51 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 729 LQRRDWENPGVTQLNSAXQXXP 794 LQRRDWENPGVTQLN P Sbjct: 89 LQRRDWENPGVTQLNRLAAHPP 110 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 392 KGG-CAARRLSWVTPGFSQSRRCK 414 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 29 KGG-CAARRLSWVTPGFSQSRRCK 51 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 1126 KGG-CAARRLSWVTPGFSQSRRCK 1148 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 317 KGG-CAARRLSWVTPGFSQSRRCK 339 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 131 KGG-CAARRLSWVTPGFSQSRRCK 153 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 41 KGG-CAARRLSWVTPGFSQSRRCK 63 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 3 KGG-CAARRLSWVTPGFSQSRRCK 25 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 15 KGG-CAARRLSWVTPGFSQSRRCK 37 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 29 KGG-CAARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 52 KGG-CAARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 57 KGG-CAARRLSWVTPGFSQSRRCK 79 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 36 KGG-CAARRLSWVTPGFSQSRRCK 58 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 288 KGG-CAARRLSWVTPGFSQSRRCK 310 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 507 KGG-CAARRLSWVTPGFSQSRRCK 529 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 272 KGG-CAARRLSWVTPGFSQSRRCK 294 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 43.6 bits (98), Expect = 4e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 728 KRRPVNCNTTHYRANW 681 KRRPVNCNTTHYRANW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 115 KGG-CAARRLSWVTPGFSQSRRCK 137 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 75 KGG-CAARRLSWVTPGFSQSRRCK 97 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 77 KGG-CAARRLSWVTPGFSQSRRCK 99 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 551 KGG-CAARRLSWVTPGFSQSRRCK 573 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 71 KGG-CAARRLSWVTPGFSQSRRCK 93 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 176 KGG-CAARRLSWVTPGFSQSRRCK 198 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 36 KGG-CAARRLSWVTPGFSQSRRCK 58 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 261 KGG-CAARRLSWVTPGFSQSRRCK 283 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 286 KGG-CAARRLSWVTPGFSQSRRCK 308 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 59 KGG-CAARRLSWVTPGFSQSRRCK 81 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 213 KGG-CAARRLSWVTPGFSQSRRCK 235 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 149 KGG-CAARRLSWVTPGFSQSRRCK 171 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 470 KGG-CAARRLSWVTPGFSQSRRCK 492 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 76 KGG-CAARRLSWVTPGFSQSRRCK 98 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 139 KGG-CAARRLSWVTPGFSQSRRCK 161 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 305 KGG-CAARRLSWVTPGFSQSRRCK 327 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 43.6 bits (98), Expect = 4e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 728 KRRPVNCNTTHYRANW 681 KRRPVNCNTTHYRANW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 36 KGG-CAARRLSWVTPGFSQSRRCK 58 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 15 KGG-CAARRLSWVTPGFSQSRRCK 37 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 155 KGG-CAARRLSWVTPGFSQSRRCK 177 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 22 KGG-CAARRLSWVTPGFSQSRRCK 44 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 4e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 799 KGGXCCXAELSWVTPGFSQSRRCK 728 KGG C LSWVTPGFSQSRRCK Sbjct: 44 KGG-CAARRLSWVTPGFSQSRRCK 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,465,361 Number of Sequences: 59808 Number of extensions: 685911 Number of successful extensions: 4423 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4404 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4742061908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -