BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B05_e34_03.seq (1440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42849| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.11 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 36 0.11 SB_27645| Best HMM Match : VWD (HMM E-Value=0.016) 29 6.9 >SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +1 Query: 163 NGFYLGKLRGLLGDGNNEPYDDFRLPNGKICXSESEFGNAYSL 291 N F +LRGL GD N E YD+F+ P G+ + +F A+ L Sbjct: 18 NPFLQNRLRGLCGDMNGEQYDEFQSPTGEFLNNADQFQKAWRL 60 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +1 Query: 163 NGFYLGKLRGLLGDGNNEPYDDFRLPNGKICXSESEFGNAYSL 291 N F +LRGL GD N E YD+F+ P G+ + +F A+ L Sbjct: 1428 NPFLQNRLRGLCGDMNGEQYDEFQSPTGEFLNNADQFQKAWRL 1470 >SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 41.1 bits (92), Expect = 0.002 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = +1 Query: 172 YLGKLRGLLGDGNNEPYDDFRLPNGKICXSESEFGNAYSL 291 Y G GL G+ N P DDF + NG+ S+ EFG ++SL Sbjct: 176 YRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSL 215 >SB_42849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +1 Query: 190 GLLGDGNNEPYDDFRLPNGKICXSESEFGNAYSL 291 GLLG NNE +D+ PNGK S EF N++ + Sbjct: 63 GLLGTNNNEHHDEMTKPNGKHAGSLIEFVNSWEV 96 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +1 Query: 190 GLLGDGNNEPYDDFRLPNGKICXSESEFGNAYSL 291 GLLG NNE +D+ PNGK S EF N++ + Sbjct: 1811 GLLGTNNNEHHDEMTKPNGKHAGSLIEFVNSWEV 1844 >SB_27645| Best HMM Match : VWD (HMM E-Value=0.016) Length = 237 Score = 29.5 bits (63), Expect = 6.9 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +1 Query: 139 LEVCYFEVNGFYLGKLRGLLGDGNNEPYDDFRLPNGKICXSESEFGNA 282 L V + FY G GL GD +N P +DF P G+ +F + Sbjct: 187 LNVLFTPTAAFY-GNTGGLCGDMDNNPANDFTGPTGERFTDAVQFAES 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,022,348 Number of Sequences: 59808 Number of extensions: 280134 Number of successful extensions: 522 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4624684138 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -