BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B04_e26_04.seq (1509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 73 2e-14 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 72.9 bits (171), Expect = 2e-14 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Frame = +1 Query: 97 PVVVHCSAGVGRSGTFITLDTALHRLAAHADTLDVFGMVYAMRRERVWMVQTEQQYICVH 276 P++VHCSAGVG +G FI +D+ L R+ + T+D++G V +R R +MVQTE QYI +H Sbjct: 867 PIIVHCSAGVGVTGCFIVIDSMLERM-KYEKTIDIYGHVTCLRAHRNYMVQTEDQYIFIH 925 Query: 277 QCLV-AVLEGQDLAP 318 L+ AV+ G P Sbjct: 926 DALLEAVICGSTEVP 940 Score = 63.3 bits (147), Expect = 2e-11 Identities = 33/71 (46%), Positives = 42/71 (59%) Frame = +1 Query: 97 PVVVHCSAGVGRSGTFITLDTALHRLAAHADTLDVFGMVYAMRRERVWMVQTEQQYICVH 276 P+ VHCSAGVGR+G FITL L R+ + LDVF V +R +R MVQTE QY + Sbjct: 1158 PITVHCSAGVGRTGVFITLSIVLERM-QYEGVLDVFQTVRILRSQRPAMVQTEDQYQFCY 1216 Query: 277 QCLVAVLEGQD 309 + + L D Sbjct: 1217 RAALEYLGSLD 1227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,248 Number of Sequences: 2352 Number of extensions: 9661 Number of successful extensions: 44 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 176781825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -