BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_B02_e10_04.seq (1509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 27 1.4 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 26 3.3 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 27.1 bits (57), Expect = 1.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 735 TGSMTIATNGSWKF*LSICVETSIPESQH 649 TG++T NG+W F S C ETS H Sbjct: 459 TGNVTDVVNGTWDF--SACEETSCAYGLH 485 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 25.8 bits (54), Expect = 3.3 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = +2 Query: 197 NSTMASTSADSQSNIAQKTWVMANNMEIVSNVDDIYRYDKKQQQDILAAKPWEK 358 N + +ST QS A +N +++N+D+IY+++ + + WE+ Sbjct: 669 NQSSSSTPNAEQSPSASSKDTFSNEY-VLTNLDEIYKFEIENDDMLSIQDYWEQ 721 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,159,969 Number of Sequences: 2352 Number of extensions: 22090 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 176781825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -