BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A12_e89_02.seq (1445 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 7.4 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 9.8 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 9.8 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 9.8 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.6 bits (46), Expect = 7.4 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +2 Query: 383 RANLASWPNEPPRPSGDATANTTAAPKPIAGNENLIQNPIRTPTPN 520 +A+ A+ P P+G T +T+A+P + + Q PT N Sbjct: 208 KASPAAAPRSVATPTGIPTPSTSASPPTVNIKKESPQMQSYRPTGN 253 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 167 SCSKLFKYHLSSRRRVASG 111 +C KLF+ SS R ASG Sbjct: 893 TCEKLFRMKKSSALRPASG 911 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 420 LGGSFGQLARFARRPPRTLLQVTNRTIA 337 +GG+ G+L R + R+ L RTIA Sbjct: 168 IGGTTGKLRRRSTAASRSRLAAFKRTIA 195 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 9.8 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 647 PSGISTRSRRRNSVILLR*RGRNSGALSIPTTS*QSNSILEDM 775 PSGIS+ N + L+ NSG LS+ T+ S + +++ Sbjct: 474 PSGISSLLNLDNQQLELKPIDLNSGDLSMLETNNLSETFTQNL 516 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,267 Number of Sequences: 336 Number of extensions: 4759 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 43120925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -