BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A11_e81_01.seq (1565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 prote... 25 7.9 AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. 25 7.9 >AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 protein protein. Length = 165 Score = 24.6 bits (51), Expect = 7.9 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 208 VAKGTELSNEVFHVVAATIYYYEDNYEAALKIFHDIELVEL 330 + +G E+ + V+ A + YED K++ + ++EL Sbjct: 47 IIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIEL 87 >AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. Length = 165 Score = 24.6 bits (51), Expect = 7.9 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 208 VAKGTELSNEVFHVVAATIYYYEDNYEAALKIFHDIELVEL 330 + +G E+ + V+ A + YED K++ + ++EL Sbjct: 47 IIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIEL 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 821,938 Number of Sequences: 2352 Number of extensions: 12431 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 184503330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -