BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A08_e57_02.seq (1430 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 77 6e-15 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 77.0 bits (181), Expect = 6e-15 Identities = 41/81 (50%), Positives = 50/81 (61%) Frame = +1 Query: 37 GVGFKKRAPRAIKEIRRFAEKXMGTPDVRVDTRLNKYLWSKGVRNVPFXXXXXXXXXXKX 216 GV FKKRAPRAIKEI FA+K M T +VRVD LNK +W +G+RNVP Sbjct: 27 GVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVWKRGIRNVPHRLRLRLSRKRSD 86 Query: 217 DEDSAHKLFTLVTYVPVASIK 279 ++D A L+T V V VA+ K Sbjct: 87 EDDKA--LYTYVQAVDVANPK 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,783,566 Number of Sequences: 5004 Number of extensions: 61873 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 75 effective length of database: 1,987,178 effective search space used: 796858378 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -