BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A08_e57_02.seq (1430 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical pr... 109 4e-24 Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical pr... 81 1e-15 >Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical protein W09C5.6a protein. Length = 122 Score = 109 bits (263), Expect = 4e-24 Identities = 50/92 (54%), Positives = 64/92 (69%) Frame = +1 Query: 37 GVGFKKRAPRAIKEIRRFAEKXMGTPDVRVDTRLNKYLWSKGVRNVPFXXXXXXXXXXKX 216 G+G KKRAPRAI EI++FA+ M T DVRVDT+LNK++WSKG++NVP+ Sbjct: 31 GIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNE 90 Query: 217 DEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 312 DEDSA KL+TL TYVP + GL NVD+ + Sbjct: 91 DEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122 >Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical protein W09C5.6b protein. Length = 70 Score = 81.4 bits (192), Expect = 1e-15 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = +1 Query: 103 MGTPDVRVDTRLNKYLWSKGVRNVPFXXXXXXXXXXKXDEDSAHKLFTLVTYVPVASIKG 282 M T DVRVDT+LNK++WSKG++NVP+ DEDSA KL+TL TYVP + G Sbjct: 1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHG 60 Query: 283 LQTENVDASQ 312 L NVD+ + Sbjct: 61 LTNVNVDSEE 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,588,292 Number of Sequences: 27780 Number of extensions: 371627 Number of successful extensions: 619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 4079417776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -