BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A07_e49_01.seq (1453 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 22 9.8 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 22 9.8 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 22.2 bits (45), Expect = 9.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 273 AFVMTIEEFNRVDILINNAGFMNDRLWE 356 AFV +++ N ++ NA N LW+ Sbjct: 115 AFVFRLKQLNAKVEMLKNARVKNTALWK 142 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 395 YSPSVSIHGKGPRXSWRYHREHCFHSIRKASSLDA 499 +SP G S+ H+EHC+ +R A D+ Sbjct: 19 WSPDTLAKNLGINSSF-VHKEHCYVLVRLARFRDS 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,067 Number of Sequences: 336 Number of extensions: 3183 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 43325775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -