BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A06_e41_02.seq (1493 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 26 2.4 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 4.3 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 4.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 7.4 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 7.4 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 26.2 bits (55), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -3 Query: 417 FHCNMXIYIYIWXVIDGASRTLXXNLFDYPSYFFNKIYHLSFC 289 FH +YIY S L LF +Y +Y+LS C Sbjct: 284 FHAQRLVYIYGVNTNHQPSDPLILKLFIITTYISGILYYLSTC 326 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 4.3 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +3 Query: 522 NRXAWSWGSHGXXGQXXAXXXGXPPAGNXC 611 N GSHG G A PP G+ C Sbjct: 349 NEGGTGCGSHGCCGGASATPHNMPPLGSLC 378 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 4.3 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +3 Query: 522 NRXAWSWGSHGXXGQXXAXXXGXPPAGNXC 611 N GSHG G A PP G+ C Sbjct: 349 NEGGTGCGSHGCCGGASATPHNMPPLGSLC 378 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.6 bits (51), Expect = 7.4 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -3 Query: 834 RTPGXMXPRAPXGPXXXGGPPGG 766 RTP P+ P P GP G Sbjct: 364 RTPSGTEPKTPTSPTGPSGPGSG 386 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 7.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 770 PGGPPXXXGPXGARGXXXPGVRG 838 P GPP GP G +G PG+ G Sbjct: 717 PPGPPGFNGPKGDKG--LPGLAG 737 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 829,213 Number of Sequences: 2352 Number of extensions: 13008 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 174749850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -