BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A04_e25_02.seq (1469 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 26 0.61 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 25 1.1 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 25 1.1 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 10.0 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 10.0 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 26.2 bits (55), Expect = 0.61 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 740 SFLFIRKKQTFDYNNTIIVFYYYECFNFNQLIALWGTRQLNLTYG 606 +F FI KK + N+ VFY F F ++AL+G Q+ + G Sbjct: 52 NFQFIDKKLN-NRNSKSRVFYENVNFQFGSILALFGVVQIYIFSG 95 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 25.4 bits (53), Expect = 1.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 141 RSCLREYQSSSPLCSDARLSC 203 R L +++ P+C D +LSC Sbjct: 96 RKVLPNFKTDEPICPDGKLSC 116 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 25.4 bits (53), Expect = 1.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 141 RSCLREYQSSSPLCSDARLSC 203 R L +++ P+C D +LSC Sbjct: 103 RKVLPNFKTDEPICPDGKLSC 123 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 10.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 355 LSELLHIFLVKFRVIFSGRVLVLLVFRNQIIDIALRLVEFHLVHA 221 LS +++ L+ F I + VLVL+V R + + + HL A Sbjct: 54 LSIIVYSILMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIA 98 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 10.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 355 LSELLHIFLVKFRVIFSGRVLVLLVFRNQIIDIALRLVEFHLVHA 221 LS +++ L+ F I + VLVL+V R + + + HL A Sbjct: 54 LSIIVYSILMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIA 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,005 Number of Sequences: 336 Number of extensions: 4083 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 43940325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -