BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A03_e17_01.seq (1445 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 24 2.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 6.5 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 823 VKSTXAASNIQYTXLKMLFNVE 758 +KS A+N+QY ++ +FN E Sbjct: 285 MKSEYGANNVQYQGVQDIFNTE 306 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 585 DDLNYNNVFVIKKINIVFNYNLI*FYDIFTQQQRDKPI 472 ++ NYNN + N NY + +Y+I +Q P+ Sbjct: 90 NNYNYNNNYNNYNNNYNTNYKKLQYYNIINIEQIPVPV 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 359,577 Number of Sequences: 438 Number of extensions: 8567 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 50242500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -