BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_A03_e17_01.seq (1445 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45940.1 68416.m04971 alpha-xylosidase, putative strong simil... 29 5.7 >At3g45940.1 68416.m04971 alpha-xylosidase, putative strong similarity to alpha-xylosidase precursor GI:4163997 from [Arabidopsis thaliana] Length = 868 Score = 29.5 bits (63), Expect = 5.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 430 KNTRANEISLHPLYRDVF*FLSEPPPPFRASCDLYGRSPMFKIKQNISVK 281 +N++AN I L P + + +E F + DLYG P++ +N+S K Sbjct: 179 ENSQANGIKLVP--NEPYTLFTEDVSAFNLNTDLYGSHPVYMDLRNVSGK 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,399,624 Number of Sequences: 28952 Number of extensions: 472644 Number of successful extensions: 742 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 3826521024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -