SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10048_5prime_partial:A_ErmoMG_comp35312_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_developmental_protein_eyes_absent_[Bombyx_mori]
Ontology
GO:0001744 P insect visual primordium formation
GO:0001746 P Bolwig's organ morphogenesis
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006470 P protein dephosphorylation
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007283 P spermatogenesis
GO:0007411 P axon guidance
GO:0007419 P ventral cord development
GO:0007435 P salivary gland morphogenesis
GO:0007455 P eye-antennal disc morphogenesis
GO:0007498 P mesoderm development
GO:0007526 P larval somatic muscle development
GO:0008134 F transcription factor binding
GO:0008406 P gonad development
GO:0008584 P male gonad development
GO:0009416 P response to light stimulus
GO:0009996 P negative regulation of cell fate specification
GO:0010628 P positive regulation of gene expression
GO:0016787 F hydrolase activity
GO:0030707 P ovarian follicle cell development
GO:0030946 F protein tyrosine phosphatase activity, metal-dependent
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0042051 P compound eye photoreceptor development
GO:0042675 P compound eye cone cell differentiation
GO:0045087 P innate immune response
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0070285 P pigment cell development
GO:0072499 P photoreceptor cell axon guidance
RNA-seq EntryA_ErmoMG_comp35312_c0_seq1
Sequence
(Amino Acid)
QLRAELEQATDNWLTLACKCLNMINSRENCVNVLVTTTQLVPALAKVLLFGLGGVFPIEN
IYSATKTGKETCFEKIKQRFGERCTYVVIGDGQDEEAAAKAKNYPFWRISSHSDIAALYN
ALDMGFL
*(41 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).