SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10040_complete:A_ErmoMG_comp35305_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_ADP-ribosylation_factor_2_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0003956 F NAD(P)+-protein-arginine ADP-ribosyltransferase activity
GO:0005525 F GTP binding
GO:0005575 C cellular_component
GO:0005622 C intracellular anatomical structure
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006471 P protein ADP-ribosylation
GO:0006810 P transport
GO:0007264 P small GTPase mediated signal transduction
GO:0007269 P neurotransmitter secretion
GO:0015031 P protein transport
GO:0016192 P vesicle-mediated transport
GO:0016197 P endosomal transport
GO:0048488 P synaptic vesicle endocytosis
GO:0048749 P compound eye development
GO:0098793 C presynapse
RNA-seq EntryA_ErmoMG_comp35305_c0_seq2
Sequence
(Amino Acid)
MGLTISSVFTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYYQNTQGLIFVVDSSDRKRISEAENELANMLKEDELRDAV
ILVFANKQDMPNAMTAAELTNALNLGNLRNRRWYIQATCATQGQGLYEGLDWLSNELAKK
*(59 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).