SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG1003_5prime_partial:A_ErmoMG_comp18825_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_cytochrome_b5-like_[Amyelois_transitella]
Ontology
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005811 C lipid droplet
GO:0009055 F electron transfer activity
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0020037 F heme binding
GO:0031090 C organelle membrane
GO:0035206 P regulation of hemocyte proliferation
GO:0043231 C intracellular membrane-bounded organelle
GO:0045610 P regulation of hemocyte differentiation
GO:0046872 F metal ion binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_ErmoMG_comp18825_c0_seq1
Sequence
(Amino Acid)
FLCVWGGRRRPHRHIKMGEIQKYTLADVAARNGRNGPLWIVYKDSVYDMTNYVNEHPGGG
DPIIEEAGKDATKEFDDSGHTADARTIMVKYKIGEIIEEEKKYDANGKKKKRVVSAPPEK
NNRSCINVITCGLIG
*(44 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).