SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10039_complete:A_ErmoMG_comp35305_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
enoyl-CoA_hydratase_domain-containing_protein_3_[Agrotis_segetum]
Ontology
GO:0003824 F catalytic activity
GO:0005739 C mitochondrion
GO:0008152 P metabolic process
RNA-seq EntryA_ErmoMG_comp35305_c0_seq2
Sequence
(Amino Acid)
MLSLIQKKSPRSFIILRRFLHNDYVTTMENNGTREIILNHEKTKNSLSLNMMNHLIEAIN
NNKEDISLRAIVLSAKGNVFSAGHNLKELQQSDDDQCRLVFSKATELMKSIVLSPVPVIA
KVNGLATAAGCQLVASCDMILCSDSSKFSTPGANFGIFCSTPGIALGRCVPKSKATYMLF
TGESISAQEAYQSGLVTKVVPANELDNEVEKLIEKIKHKSRSVISLGKQFFYQQMELGLF
NAYALGEKVMVDNIESKDGQEGLMSFVEKRKAKWSHR
*(91 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).