SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10037_5prime_partial:A_ErmoMG_comp35304_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_6-phosphogluconolactonase_isoform_X1_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005975 P carbohydrate metabolic process
GO:0006098 P pentose-phosphate shunt
GO:0009051 P pentose-phosphate shunt, oxidative branch
GO:0016787 F hydrolase activity
GO:0017057 F 6-phosphogluconolactonase activity
GO:0048029 F monosaccharide binding
GO:0070062 C extracellular exosome
RNA-seq EntryA_ErmoMG_comp35304_c1_seq1
Sequence
(Amino Acid)
IGLSGGSVVKYLCEGLPEVETEWSKWKLAFCDERVVPEDSNDSTFGTYKKDLIPKTGLKE
SQFITIKQGVSAEEAAIDYTEKLKNAFGSDDFKFDLLLLGMGPDGHTCSLFPDHKLLTET
ELPVAAITDSPKPPPERITLTYPVINRARNCIFAICGSGKADMVKRILKDNEDLPAGRVK
PSNGSLFWILDEEAAAHL
*(65 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).