SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10030_internal:A_ErmoMG_comp35300_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_cytosolic_10-formyltetrahydrofolate_dehydrogenase_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006730 P one-carbon metabolic process
GO:0008152 P metabolic process
GO:0009058 P biosynthetic process
GO:0009258 P 10-formyltetrahydrofolate catabolic process
GO:0016155 F formyltetrahydrofolate dehydrogenase activity
GO:0016491 F oxidoreductase activity
GO:0016620 F oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016742 F hydroxymethyl-, formyl- and related transferase activity
GO:0019145 F aminobutyraldehyde dehydrogenase activity
GO:0047105 F 4-trimethylammoniobutyraldehyde dehydrogenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
RNA-seq EntryA_ErmoMG_comp35300_c1_seq1
Sequence
(Amino Acid)
VNADSGKVLTLINPTDESVICKVQSASPNDVDKAVKAAKKAFDEGEWAKISARERGQMLF
KLADLMEQHKEELATIESIDSGAVYTLALKTHVGMSIDTWRYFAGWCDKIQGTTVPINHA
RPN
(40 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).