SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG1001_complete:A_ErmoMG_comp18824_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_monocarboxylate_transporter_5_[Amyelois_transitella]
Ontology
GO:0005308 F creatine transmembrane transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0015129 F lactate transmembrane transporter activity
GO:0015293 F symporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0035879 P plasma membrane lactate transport
GO:0055085 P transmembrane transport
GO:1902598 P creatine transmembrane transport
RNA-seq EntryA_ErmoMG_comp18824_c0_seq1
Sequence
(Amino Acid)
MSTEKIALVPTPKTKKVVKLIPPEGGWGWMVLAGVALSNIVNQSMLSLFSLLYGDSLQAM
GHSTQGAAVVISTMLFVTNFAGPIAGAIVKVTSPRLVAVIGACSCTAGIFLSGYSTNIVH
LILTYGFLLGLGLGFIQNSSFVAINGYFKIRKSRAVGLANVGTGVGQTLMPHLVRYLLEN
YDFQGACLILSSISLNGICGTLLMQPVEWHMKKVEEEVVIEENQQLLDNKHKDIVIRKDS
QIINEIKGLNTTATAPELNEKEKEIERNQNNLQSRNELNSNGANGTTIHRIRAPQQKSLI
RKIGDLFDVSLLLSPRFLNIIIGTALSVTSIQNFSMLYPLFLQEVADMDKQQTATCMSAV
AAADIVGRLVLPTFQDKYKIKARWMLIMTCVWLIVIRQILAFQNQFTVLIMMSCLYGFGR
SMVIVARNIAISENCRMDQVPAAVGLGMLTMGIIVPPAGYFLGWIRDFTDSYIICITAQN
VLLVVLLATWIPDMMLLRLQERRKKTIHEAEST
*(170 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).