SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_ErmoMG10012_5prime_partial:A_ErmoMG_comp35299_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_neurofilament_heavy_polypeptide-like_isoform_X3_[Bombyx_mori]
Ontology
GO:0001726 C ruffle
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0007010 P cytoskeleton organization
GO:0008360 P regulation of cell shape
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0031267 F small GTPase binding
GO:0035023 P regulation of Rho protein signal transduction
GO:0042995 C cell projection
GO:0043087 P regulation of GTPase activity
GO:0043547 P positive regulation of GTPase activity
GO:0046847 P filopodium assembly
GO:0046872 F metal ion binding
RNA-seq EntryA_ErmoMG_comp35299_c0_seq1
Sequence
(Amino Acid)
RVRARGAASPRWVSRTLLLAHNLLYAFRTPDCSKADCMIYLEGFTVCAAGEVKSRAHAFK
VYHTGNAFYFACESRDDMLAWIQLIHRATLLPSLGHQLDVSKQFSETDYSETESDSESPE
KRSDKDKEKEKEKEKDKEKEKDKDKSKFGSLKKLTHMMQRSESQEIVSHSSTSLDRKYLR
FFLRNKSKDDTKPAKSKPSGVPVPTEHYRSYRRLASDTPPSTSANMSANTSANTSASMSA
SKSGLPVETRANKLPKPINYIHASNPNLLDFEKSDFVTKPTLQIPKPKPKMESGPVGVTL
EQFMLEKQAEERRQIYSERVLLGVRRDQRDARDQRPQRDLQTRLDSIVPDVIYGEVRAGS
ALQARALPPAPAPATATHTNTNLNSTNLKPISVKGKDGYERLVYRGEEKPAWGRNHKVHS
TQRGAAQSPRTRGNESWGAEGGVSRLRLVFGDNQSGSRGEYPHLVCPPTFRPETYSLQHN
NTHDTYTSQ
*(162 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).