SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1003_internal:A_BomoEE_comp22311_c0_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		putative_hyperpolarization_activated_cyclic_nucleotide-gated_potassium_channel,_partial_[Operophtera_brumata]
Ontology
GO:0000155 F phosphorelay sensor kinase activity
GO:0000160 P phosphorelay signal transduction system
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005267 F potassium channel activity
GO:0005516 F calmodulin binding
GO:0005622 C intracellular anatomical structure
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0009986 C cell surface
GO:0010389 P regulation of G2/M transition of mitotic cell cycle
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0023014 P signal transduction
GO:0034765 P regulation of ion transmembrane transport
GO:0042391 P regulation of membrane potential
GO:0044325 F transmembrane transporter binding
GO:0046982 F protein heterodimerization activity
GO:0055085 P transmembrane transport
GO:0071805 P potassium ion transmembrane transport
RNA-seq EntryA_BomoEE_comp22311_c0_seq1
Sequence
(Amino Acid)
TLFSFVTIHITGPDPYDYFILYADAIAFINVIICFITGYLDEGHKKIILEPKLIIKQYLK
TNFIFDLIGCLPLQMIQPFHDCRYPSHTIFLIFKLFRLVALDY
(33 a.a.)

- SilkBase 1999-2023 -