SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoEE10014_5prime_partial:A_BomoEE_comp63854_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
PREDICTED:_E3_ubiquitin-protein_ligase_HECTD1_isoform_X1_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0010091 P trichome branching
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0042023 P DNA endoreduplication
GO:0042787 P ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomoEE_comp63854_c0_seq1
Sequence
(Amino Acid)
RGRGVCAGARVSRGPDWKWRDQDGPHPALGTLTSELHNGWVDVRWDHGVRNSYRMGAEGK
FDLKVVSGGTVIESSKASRKSHSTPSLPDATSVDQVSVASTEQASSADNISSEEMVSNMS
RPRTHATDLSAINNSTHHINSVFDIDLATIVESLTLGAESNNCITELGNTSFTNMEMGPT
SITDITKPYPAKEPLPESSAHECDENEAGESQYGDNKKESQSGSGTMSASEPDLTQQGTG
RLLESLGVGRGNSAGRGSNVPRSNRNNHSSGLLPSLVRLALSSNFPGGLLSAAQSYPSLS
SNAQNALTLSLTSTSSESEQVSLEDFLESCRAPALLTELEDDEDGDEALDSDKENEPTYQ
EVSRNLLSLMEEEALEALRGSSGSGQNNRSRRPWDDDFVLKRQFSALIPAFDPRPGRTNL
NQTVDLEIPLNEESEEEESWEEVPENVGGGATSETGRAPALRLVLSAGGASLPLARGSWT
LYRAVLLLHARLPHADLHRDTTYTLTYKEVEGSEGAFASSDTEDDEPNDPEGGIVGAEGS
EGGMATSCVRVLRRLRAAAPELPAEPFLSTKLTNKLHLQLQEPLALAAAATPHWCQQLID
WCPFLFPLETRQMFFACTAFGTSRTIVWLQAQRDRALDRQRATNTVSPRRAELEATEFRM
GRLRHERVRIPRDPDMLRSAIQVMRVHASRKSVLEVEFAGEEGTGLGPTLEFYALVAAEL
QRADLALWLHDAPLHVDDDAPLHLMQPTEKPPGYYVSRPGGLFPAPLPQESPICDKVCKY
FWFLGVFLAKVLQDGRLVDLPLSEPFLRIMCGEELTKENLQEIDPIRHRFLEKMLEAAEG
YDKIMRDESLDENEKQKRVSELNVDGAAFEELSLTMTHIAPNVDPAVAVQPLCDGGEHIE
VGAHNARLYAEWSARWMVSAGVRRQVAWFKRGFARVFPPRRLRAFSPSELRLLLCGERGP
VWTREHLLQYTEPKLGYTRDSPGFLRLVDVLVEMSICERKAFLQFATGCSSLPPGGLANL
HPRLTVVRKVDAGDGSYPSVNTCVHYLKLPEYSCKEVLRERLLAATNERGFHLN
*(357 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).