SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
NameO_BomoEE10010_complete:A_BomoEE_comp63851_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_activating_transcription_factor_7-interacting_protein_1_[Papilio_machaon]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003714 F transcription corepressor activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006306 P DNA methylation
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0016887 F ATP hydrolysis activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045898 P regulation of RNA polymerase II transcription preinitiation complex assembly
RNA-seq EntryA_BomoEE_comp63851_c0_seq1
Sequence
(Amino Acid)
MQLVVECQSTPDIKADMSALEDILDTKLSSNTFIEDLKTNKSHQGNKENIFEDNCAVVNG
KASIPDTIEASANTNCIVPHDELENSDLDEKLTENDTEVSKGNHTNDLLLESDQAQEIEQ
KNDKDSAETHKCNSDGIILLNKNPEIKVSSEFSIGPKVSAEEDIKISQNAPDPVERIDDK
DECQQQENPEKVHKGSNIELNNSVSDHIQSINEYSEIAVPIKKDEVLTMEVVDHDSTNIV
INSADTVVIVQDDVKDKSESTAQNTTDSCDGIDNKEDNSKKTPDKVCSDSDNENTIEKRE
KMEEEENITLEVIDVDKDEKNAIDTVDLQNELCKETQSSNAVFCSETEIQPVEIPIVSQN
ANSFSSPNQAMEVDTSPALKPPETSISNVHIVDLDEVTDSTTNSQTADKSEALAEIQKEP
VKKVCRLSNTLDILSDEEDELANTKNTPEVVINEKPVEKHCINIEDDDDIMVIEDTKEPN
REMLTNKSDTTADGTKEITVEVTVENGEQKSNFMESIELSCNKVTKGDDSEHSKPDETLK
VKSPEKLFKGPDETKLEKITDKPLVPTDFLKTSKKTLASMTREELEEFCILKIVESVVDR
INLADTQSNLKTLAQSLDDYEKKTKMLAKQNRDLQVVLKSIQEEQKKTFSNSKPITPLKI
TRSVGMQVLMTDKSSLMLRKKVPQAPSAVPPLSIIKTRNQNNQSPQRSQASSKAPTNNEN
IPVPRLIPASNNTAKNNPKPTSPPSSSKASVSPMNGLRSNTAQKIPEKRTLSKDTSVTVD
LTDDEPPNKVVARNPQPPVRLVSPQTLMGPQRSHFGQGIANSHRKVFIPISGPGPNGQAR
STQAVLIKPHPPGMQRPRTAAPNIGRAQNQIKTNKPNQVHRHPAPMPEIMKQYHPPNWKA
LPPAPDLKLSKVENGIVISWKINGYQEDSYEEIASYQLYAYQETSAPPSTALWKKIGDVK
ALPLPMACTLTQFTAGYSYYFAVRAVDVKSRLGPFSEPGSILLPNKI
*(335 a.a.)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).